Year 2022-23 Palghar Municipal Council Provide Construction Material For The Construction ...

Contract Award Notice

Work Detail

Year 2022-23 Palghar Municipal Council Provide Construction Material For The Construction Department To Maintain And Repair Roads Gutter And Beauilding Palghar Municipal Council Area- 1 Fixing Chainage Stone / Bench Mark Stone / Center Stone / Apex Stone In Earth And All Sorts Of Soil And Soft Murumincludingconveyingexcavatedmaterial, Fixingstone, Includingpaintainingletteringnumbersand Back Filling Etc. Complete. 2 Taking The Trial Pit For Roads, Alignment, C.D. Works In Earthsoil Of All Sorts, Sands Gravel Or Soft Murum, Including Stacking The Excavated Material Including All Lifts And Necessary Back Filling Upto Depth 1.5 Meters 3 Taking The Trial Pit For Roads, Alignment, C.D. Works In Earth Soil Of All Sorts, Sands Gravel, Or Soft Murum, Including Stacking The Excavated Material Including All Lifts And Necessary Back Filling Upto Depth 3.0 Meters 4 Takingthetrialpitforroads, Alignment, C.D.Worksinhardmurum, Includingstackingtheexcavated Material Including All Lifts And Necessary Back Filling Upto Depth 1 5 Meters 5 Takingthetrialpitforroads, Alignment, C.D.Worksinhardmurum, Includingstackingtheexcavated Material Including All Lifts And Necessary Back Filling Upto Depth 3.0 Meters 6 Taking The Trial Pit For Roads, Alignment, C.D. Works Inhard Murum, And Boulders Including Stacking The Excavated Material Including All Lifts And Necessary Back Filling Upto Depth 1.5 Meters 7 Taking The Trial Pit For Roads, Alignment, C.D. Works Inhard Murum, And Boulders Including Stacking Theexcavated Material Including All Lifts And Necessary Back Filling Upto Depth 3.0 Meters 8 Fixing Survey Pegs In Earth And All Sorts Soil, Sand, Gravel, Soft Murum, Etc. Including Conveying, Fixing Etc.Complete. 9 Reconnaisancesurveyofroadalignmentinplain Countryincludingtakingthreedimensionsofapexes, Verification Of Type Of Land Etc. Alongwith The Alignment Etc. Complete ( Without Chaining ) . 10 Reconnaisancesurveyofroadalignmentinplain Countryincludingtakingthreedimensionsofapexes, Verification Of Type Of Land Etc. Alongwith The Alignment Etc. Complete ( With Chaining ) . 11 Reconnaissance Survey Of Aroad Alignment For New Hilly Road Utilising Exsisting Forest Cart Tracks With Use Of Ghat Tracer ( If Found Necessary ) , Taking Three Dimensions Of Apexes Including Verification Of Type Of Land Etc.Complete. ( Without Chaining ) 12 Reconnaissance Survey Of Road Alignment For New Hilly Road Utilising Exsisting Forest Cart Tracks With Use Of Ghat Tracer ( If Found Necessary ) , Taking Three Dimensions Of Apexes Including Verification Of Type Of Land Etc.Complete. ( With Chaining ) 13 Reconnaissance Survey Ofroad Alignment In Hilly Road Utilising Exsisting Forest Cart Tracks With Use Of Ghat Tracer ( Iffoundnecessary ) , Takingthreedimensionsofapexesincludingverificationoftypeoflandetc.Complete ( Without Chaining ) 14 Reconnaissance Survey Ofroad Alignment In Hilly Road Utilising Existing Forest Cart Trackswith Use Of Ghat Tracer ( Iffoundnecessary ) , Takingthreedimensionsofapexesincludingverificationoftypeoflandetc.Complete ( With Chaining ) 15 Detailedsurveyofroadinplaincountryincluding Chaining Andlevelling Withcrosssectionsateverytwochains Inclusive Of Closing Of Survey Each Day. 16 Detailedsurveyofroadlengthwhere Earthworkis Partlydone Including Chaining Andlevelling Withcrosssections At Every Two Chains Inclusive Of Closing Survey Each Day. 17 Detailed Surveyof Road Throughhilly Country Taking Cross Section At Every Chains Or As Required Includingchaining Levelling And Closing Survey Each Day. 18 Detailedsurveyofroadthroughhillycountrytakingcrosssectionateverychainsasdesiredincludingchaininglevelling And Closing Survey Each Day Utilising Existing Cart Track. 19 Providing And Fixing Wooden Survey Pegs Including White Washing Etc. Complete. 20 Carrying Out Catchment Area Traverse Survey Of Minor Stream ( Not Traceable In Toposheet ) Below 100 Acres 21 Cutting Down Branches Of Trees , Bushes Etc. Stacking The Material Neatly As Directed ( For Motarable Road ) 22 Providingdetailedlayoutplanofareainscale1:500Includingcarryingoutcontoursurveyanddetailed Engineering Plane Table Survey With The Help Of 24 Alidade. The Dolomite Area Measurement Of The Plot And Structures, Trees, Over Head Line And Under Ground Service Amenities Within The Area, With Triangular Method And Giving Detailes Of The Structures, Such As Total Area, Type Of Building And Distance From All Corners Taking Trial Pit 0.5X0.5X2.00 M.-2Nos. Per Acre And Collection Of Record From City Survey / D.I.L.R. Authorities And Authentication. The Plan Shall Be Traced On 75 Micron Polyster Film And Shall Be Submitted Along With Three Amoniaprints.Thecontourlevelsshallbemarkedat0.5Meterintervals.Note:-Theitemsincludes- 1 ) Traversingworkwiththeodoliteandsteeltape.2 ) Levellinggridworkoftheterrain. 3 ) Detailed Engineering Survey And Contouring Work Of The Terrain.4 ) Plotting Work.5 ) Collection Of Record.A ) Up To 1 Acre 23 Providingdetailedlayoutplanofareainscale1:500Includingcarryingoutcontoursurveyanddetailed Engineering Plane Table Survey With The Help Of 24 Alidade. The Dolomite Area Measurement Of The Plot And Structures, Trees, Over Head Line And Under Ground Service Amenities Within The Area, With Triagular Method And Giving Detailes Of The Structures, Such As Total Area, Type Of Building And Distance From All Corners Taking Trial Pit0.5X0.5X2.00M.-2Nos.Peracreandcollectionofrecordfromcitysurvey / D.I.L.R.Authoritiesand Authentication. The Plan Shall Be Traced On 75 Micron Polyster Film And Shall Be Submitted Along With Three Amoniaprints.Thecontourlevelsshallbemarkedat0.5Meterintervals.Note:-Theitemsincludes- 1 ) Traversingworkwiththeodoliteandsteeltape.2 ) Levellinggridworkoftheterrain. 3 ) Detailed Engineeringsurveyandcontouringworkoftheterrain. 4 ) Plottingwork. 5 ) Collectionofrecord. B ) Above 1 Acre 24 Reconnaisance Survey Including Study Of Sheets, Maps Etc.For Alignmentincluding 3Dimensionofapexes, Fixing Pegs, Chain And Compass Or Cross Staff Survey With L-Section And Cross Section Of Alignment At Every 30 M Or At Every Change Of Deviationwhichever Is Less Including Fly Levelsat Closing Of Day, Fixing Apexandb.M. Stones Of Size 0.20*0.20*0.75 Min1:2:4 C.C. At Every 200 M And Preparation Of Alignment Plans Andall Tpe Of Compliance If Reqired From Department 25 Preparationofdetailedplansandestimatesofroadincludingtypingin5copies, Ammoniaprints, With Colouring Of Plans, Proper Filing, Indexing And Paging Etc. Complete And All Types Of Compliance, If Requiredfrom Department 26 Survey Of C.D. Works Including Taking L-Section Of Road, Catchment Area Plan By Traverse Method And Takingtrial Pits Of Size 1.00X1.00X1.50 M Including Preparation Of Detailed Plans And Estimates In 5 Copies And All Types Of Compliance If Required From The Department 27 Survey Of Minor Bridge Including Taking L Section Of Existing Road And Two Defined Cross Sections , One Of U / S And One Of D / S, One Vergin Cross Section On Alternateproposed Cross Sections And Bed Slope Of Stream Upto Sufficient Long Distance As Required With Chain And Compass. Taking Three Trial Pits Of Size 1.00X1.00X3.0 M Andcollecting Samplesof Materialsatsite Forascertaining The Siltfactor, Unitweighttest, Specificgravity From Govt.Approvedlaboratories ( Testingchargestobebornebytheagency ) Andpreparationofdetailed Survey Data, Submissionof The Project Duly Typed Andcolouring Of The Ammonia Prints, Site Plan Andother Drawings Etc. Complete If Required From The Department. 28 Survey Of Major Bridge Including Taking L-Section Of Existing Road Two Defined Cross -Sections ( One At U / S And One At D / S ) And One Vergin Cross Section On Alternateproposed Cross Sections And Bed Slope Of Stream Upto Sufficient Long Distance As Required With Chain And Compass.Taking 5 Trial Pits, Three In Bed, Two On Banks Of Size 2.00X2.00X3.00 M For Collecting Samplesofmaterials At Site For Ascertaining The Silt Factor, Unit Weight Test, Specificgravityfromgovt.Approvedlaboratories ( Testingchargestobebornebytheagency ) And Preparation Of Detailed Survey Data, Submission Of The Project Duly Typed And Colouring Of Ammonia Prints, Site Plan And Other Drawings Etc.Complete. And All Types Of Compliance If Required From Department. ( Excluding Taking Trial Bores And Contouring ) 29 Contoursurveyofstreamu / Sandd / Sofproposedbridgesiteincludinglevelling Atevery30x30mpreparing Contour Map With Autocad Prints Etc Complete In 5 Sets 30 Surveyofraisedcausewayincludingreconnaissance, Takinglsectionofexistingroadonedefinedone Vergin One Alternate Proposed Cross Section And Stream Upto Sufficient Lengths With Chain And Compass Taking Two Trial Pits Of Size 2.00X2.00X3.00 M. Collecting Samples At Site Ascertaining Silt Factor And Preparation Of Detailed Survey Data, Submission Of The Project Duly Typed Colouring Of The Ammonia Prints, Site Plan And Other Drawing Etc.Complete If Required From Deparetment. 31 Preparation Of Detailed Plans And Estimates Of Raise Causeway On The Basis Of The Approved Detailed Survey Databycompetentauthorityincludingtypingin5copiesammoniaprintssiteplanotherdrawingswith Colouring Ofplansproperfilling Indexing Andpaging Etc.Completeandalltypesofcompliance Ifrequiredfrom Department 32 Completesurveyofstreamhavingcatchmentareaupto1sq.Mileincludingcatchmentsurveytakingnecessary L.S. / C.S. And Other Details Etc. Complete. 33 Complete Surveyofstream Having Catchmentareaabove 1Sq.Mile Andupto5sq.Miles Including Takingnecessary L.S. / C.S. And Other Details Etc. Complete. 34 Reconnaissancesurveyofalignmentinplaincountryforapproachestothebridgeincludingtakingthreedimensions Of Apexes. ( Without Chaining ) 35 Fly Levelling For Carrying Out Bench Mark. 36 Detailed Survey Of Approaches Including Chain And Compass Survey Along Bridge Alignmentand Approachesincluding Closing Each Day Work. 37 Taking Longitudinal Section Of Streams Extending Upstream And Downstream Side Of Thebridge Site, Requisite Number Of Cross Section Of The Stream On Either Sides Block Contouring And Other Details Etc. Complete. ( Lengthof L Sand C Sfor Contouring To Be Worked Out ) 38 Demarcation Of Right Of Way ( Row ) As Per Design Using Total Station Including Calculation Of Co-Ordinates Of30 Meter Interval On Both Sides Of Road. 39 Preparation Of Land Acquisition Proposalincluding Collection Of 7 / 12 And 8 / A Documents Marking Alignment On Village Maps , Area Calculation, Preparation Of Proposal, Printing, Binding, Etc. Complete And Submission Of5sets More Ever Liasoningand Coordination With Revenue Authorities With Compliance If Any Until Finalisation Of Award Includingjoint Measurement Of The Alignment.For New Alignment. 40 Preparation Of Land Acquisition Proposalincluding Collection Of 7 / 12 And 8 / A Documents Marking Alignment On Village Maps , Area Calculation, Preparation Of Proposal, Printing, Bindind, Etc. Complete And Submission Of5sets More Ever Liasoningand Coordination With Revenue Authorities With Compliance If Any Until Finalisation Of Award Includingjoint Measurement Of The Alignment.For Existing Alignment. 41 Carryingof Detailedtopographicsurveybyusing Totalstationalongthe Existing Ornewroadincluding Taking L-Section Andcross Section At Every 30 Meter Row , Taking At Least 10 Spot Levels Per Crosssection, Picking Upallexisting Details Inside The Rowlike Electrictelephone Line , Encroachments, Structuresetc. Connecting Allthe Primary Totalstationcontrolpoints Byg.I.S.Benchmarkslevelorwhicheveravailable With Department Using Auto Level And Preparing Autocad Plan By Using Above Data Taking Out 1 Set Of Black Andwhiteprintouton50micronpolysterfilmsheeta2sizeand2setsofcolouredprintouton A2size Submitting Soft Copy All Data On Cd. Plain Terrain New Alignment 42 Carryingof Detailedtopographicsurveybyusing Totalstationalongthe Existing Ornewroadincluding Taking L-Section Andcross Section At Every 30 Meter Row , Taking At Least 10 Spot Levels Per Crosssection, Picking Upallexisting Details Inside The Rowlike Electrictelephone Line , Encroachments, Structuresetc. Connecting Allthe Primary Totalstationcontrolpoints Byg.I.S.Benchmarkslevelorwhicheveravailable With Department Using Auto Level And Preparing Autocad Plan By Using Above Data Taking Out 1 Set Of Black Andwhiteprintouton50micronpolysterfilmsheeta2sizeand2setsofcolouredprintouton A2size Submitting Soft Copy All Data On Cd. Plain Terrain Existing Alignment. 43 Carryingof Detailedtopographicsurveybyusing Totalstationalongthe Existing Ornewroadincluding Taking L-Section Andcross Section At Every 30 Meter Row , Taking At Least 10 Spot Levels Per Crosssection, Picking Upallexisting Details Inside The Rowlike Electrictelephone Line , Encroachments, Structuresetc. Connecting Allthe Primary Totalstationcontrolpoints Byg.I.S.Benchmarkslevelorwhicheveravailable With Department Using Auto Level And Preparing Autocad Plan By Using Above Data Taking Out 1 Set Of Black Andwhiteprintouton50micronpolysterfilmsheeta2sizeand2setsofcolouredprintouton A2size Submitting Soft Copy All Data On Cd. Hilly Terrain New Alignment 44 Demarcationofroadboundry ( Row ) Includingfixingtheboundrystonesofstandardsize Andshape Including Fixing In Block Of Standard Size Of C.C. Of 1:4:8 White Washing At 30 M Interval On Both Sides 45 Taking Trial Bores 75 To 100 Mm For 53.0 To 88.9 Mm Core Dia Over Burden ( By Diamond Drilling Machine ) Such As Soil Of All Sorts, Soft Murum, Hard Murum And Boulders And In Soft Rock Including All Materials Such As Casing Pipes And Accessories Oil, Grease, Steel, Rods, And Such Other Materials As Required ( Including Conveying The Material To Site Of Work ) . Preserving The Loose Sample In Glass Jar And Core Sample Serially On Site Of Work And Conveying The Same To Hq Of Concernring Office As Directed.A ) Over Burden 0 To 50 Meter. 46 Takingtrialbores75to100mmfor53.0To88.9Mmcorediainrocksasspecifiedbelowincludingall Necessary Materials Such As Oil, Grease, Steel Boostan And Such Other Materials As Required ( Including Conveying The Material To Site Of Work ) And Preserving The Core Sample Serially On Site Of Work And Conveying The Same To Hq Of Concernring Office As Directed.Quartzite With Diamnd Drill With Nx Bit 0 To 50 Metre 47 Takingtrialbores75to100mmfor53.0To88.9Mmcorediainrocksasspecifiedbelowincludingall Necessary Materials Such As Oil, Grease, Steel Boostan And Such Other Materials As Required ( Including Conveying The Material To Site Of Work ) And Preserving Thecore Sample Serially On Site Of Work And Conveying The Same To Hq Of Concernring Office As Directed.Quartzite With Diamond Drill With Ax Bit0 To 50 Metre 48 Takingtrialbores75to100mmfor53.0To88.9Mmcorediainrocksasspecifiedbelowincludingall Necessary Materials Such As Oil, Grease, Steel Boostan And Such Other Materials As Required ( Including Conveying The Material To Site Of Work ) And Preserving The Core Sample Serially On Site Of Work And Conveying The Same To Hq Of Concernring Office As Directed.Othrk Ith Di D D Ill0 T 50T 49 Providing Tun Tappa Core Boxes Of Junglewood Of Size1.25Mx 0.35X 0.15Mfor Preservingcore Samplewithall Fixtures Andfasteninghandles Includinglocking Arrangment Etc . Complete. 50 Providing And Maintaining Temparory Platform Of Bore Location In River Bed In Upto 1M Of Standing Water And Of Size 3.50 X 4.00 M By Using Sand Bags In Layer For Platform Including Allrequired Materials Labours Etc.Complete. 51 Providingandmaintainingtemporaryplatformforerectingboringmachinedinriverbedtothedepthof Standing Water 1M To 2Mand Of Size 3.50 X 4.00 M By Using 20 Nos. Of M.S. Empty Barrels In M.S. Frame Made Of M.S. Angle Size 50 X 50 X 5 Mm With Fabrication And Over It A Jungle Wood Planks Platform Of Size3.50X4.00X0.03Msizeincludingsupplyingofnylonrope24mmdia.Foranchoringplatforminclude Passage Platform And Enganging A Labour Etc. Complete.1 M To 2 M 52 Providingandmaintainingtemparoryplatformforerectingboringmachinedinriverbedtothedepthof Standing Water 2 M And Aboveand Of Size 3.50 X 4.00 M By Using 20 Nos. Of M.S. Empty Barrels In M.S. Frame Made Of M.S. Angle Size 50 X 50 X 5 Mm With Fabrication And Over It A Jungle Wood Planks Platform Of Size 3.50 X 4.00 X 0.03 M Size Including Supplying Of Nylon Rope 24 Mm Dia.For Anchoring Platform Include Passage Platform And Enganging A Labour Etc. Complete.2 Mand Above. 53 Providing And Maintaining Temparory Platform For Inspection From One Bank To Another Bank Of Bore Location In River Bed In All Depth Of Standing Water Of Size 1.30 X 2.00 M By Using 4 Nos. Of M.S. Empty Barrels In M.S. Frame Madeofm.S. Angle Size 50 X 50 X 5 Mm With Fabrication And Over It A Jungle Wood Planks Platform Of Size 1.30 X 2.00 X 0.03 M Size Including Supplying Of Nylon Rope 24 Mm Dia. And 300 M Length Of Movement Of Platform Enganging A Labour On Inspection Days Etc. Complete. 54 Conveyingtheboringmachineandengineandallitsaccessoriesetc.Tothesiteoftheworkandback Includingloadingunloadingetc.Complete. ( Note-Distancetobemeasuredfromthestationofboringmachine Engine Etc. Of District Head Quarters To Site Of The Work By Short Route ) . 55 Shifting Boring Plant With All Its Components And Reinstalling The Same At The Directed Place Including All Itscharges Etc. Complete. 56 Providing Detailed Reports Of The Inspection Logging Of Drilled Hole By Observing Visual Description Of Data As Per Depth, Thickness Of Layer, Type Of Sample, Wash Sample, Bore Recovery Type Of Drill Etc. Complete. 57 Providing Detailed Geological Reports Of Proposed Site By Maintaining Geotechnical Investigation Of Structure Stratification Collecting Soil, Rock And Ground Water Samples For Laboratory Tests To Arrive The Foundation Design Parameters . Rock Properties Such As Type Of Rock, Jointing Fractures, Etc. Complete With Suggestion About Thesite Foundation And Remedies. 58 Preparing Land Plans And Land Schedule Including Carrying Out Plane Table Survey For Private / Forest Land On Bothsideofroadinruralandurbanareas.Theworkofplottingandcertificatefromt.I.L.R.Orother Authorities Shall Be Obtained From Correctness Of Prepared Plans. Tracing Ang Taking Out Prints And Preparing The Requisite Booklets Duly Bounds Andprinting Withall Materials Etc. Three Landplanbooklets Along With Originaltracingshallbesuppliedincludingprocurementofvillagemaps / Forestlandplansfromconcern Authorities.Note:Theitemplanetableincludesfollowingpoints1 ) Carryingoutplanetablesurvey.2 ) Plotting Of Duly Surveyed Area . 3 ) Collection Of Data Fromd.I.L.R. Authoritiesandverification Of Survey Maps By D.I.L.R. Authorities . 4 ) Preparing Three Booklets Of Survey Maps Including Taking Out Prints Of Survey Maps, Bindingetc.5 ) Carryingoutplanetablesurveyoftheprivate / Forestlandalongtheroadupto30 Meters On Either Side From The Road Centre. 59 Geometricaldesignofroadhorizontalandverticalcurvesfordesignspeedspecifiedbyircincluding Carrying Out Trail For Optimising Of Civil Cost Minimising Land Acquisition And Maximum Use Of Existing Facility Andpreparationofwideningarrangementdrawingforinsistingstructuresstakeoutdateforhorizontal Alignment And Working Levels Including Super Elevation Effect Etc. Complete. 60 Transfering And Taking Out Design On Coordinates Of Baseline On Ground Using Nails For Exsisting Road Surfaces And Survey Pegs For New Alignments Including Taking Out Coordinates For Horizontal Curves Atrequired Interval Of 50 Metersetc. Complete. ( Extralinesuch As Right Of Way Median Edges To Toe Line Not Included ) . 61 Preparationofroadway, Drawing ( Planandprofile ) Oncomputerbyusingautocadofrequiredscale Showing All Topo Feature Andproposedconstructiondetails Suchas Carriage Way , Medianservice Road, Toe Line, Retaining Walls, Cross Drainage Works, Major Structures, Etc. Complete. Including Indexing, Level Tables, Legendbasic Information Of Project And Design Details Etc 62 Preparation Of Engineering Drawing As Strip Plan, Widening Scheme, Index / Key Map, Typical Cross Section, Retaining Walls, Road Furniture, General Arrangement Drawings For Bus Bays / Truck Lay-Bays / Rest Areas / Toll Plaza / Booths / And Type Drawing Of Pipe / Slab Drains Etc. On Computer Using Auto Cad. 63 Survey Of C.D. Works Including Taking L-Section Of Road, Catchment Area Plan By Traverse Method And Takingtrial Pits Of Size 1.50M X 1.50M X 1.50M Including Preparation Of Detailed Plans And Estimates In 5 Copies And All Types Of Compliance If Required From The Department 64 Designofjunctionsincludingdetaillayoutoftrafficsigns, Informatoryboardstrafficislands.Breaksin Median Verge Including Working Levels At Junctions As Per Irc Standards Etc. Complete.A ) Major Junction 65 Designofjunctionsincludingdetaillayoutoftrafficsigns, Informatoryboardstrafficislands.Breaksin Median Verge Including Working Levels At Junctions As Per Irc Standards Etc. Complete.B ) Minor Junction 66 Preparaionof Initial Designof Flyovers Withpreparing General Arrangement Drawing With Dimensions Etc. Complete And Preparation Of Rough Estimate For All Components Of Bridge. Including Supplying Four Copies Of Coloured Drawings And Copy Of Drawing On C.D. ( Excluding Geotechnical And Structural Design Part. ) 67 Preparation Of Draft / Final Report Comprising Of Technical, Financial Economic Feasibility And Environmental Aspectsofthe Projectincluding Executivesummaryanddetailedchaptersonnecessityandintroductionof Projectexistingandfuturetraffic, Designphilosophyscopeofwork, Summaryofavailablecostestimates Justification For Rates Adopted, Key Points Of Execution, Salient Features Of The Project, Location Of Toll Plaza, Toll Rate / Policytobeadoptedandspecificationofmajorconstructionitemsetc.In8copieshavingattractive Cover And Binding S Directed By Engineer In Charge Etc. Complete. 68 Preparation Of Autocad Drawing With Colour Print For Building / Bridge / Road / Cd Works In Required Sizeetc. Complete. - A-0 Size 69 Preparation Of Autocad Drawing With Colour Print For Building / Bridge / Road / Cd Works In Required Sizeetc. Complete. A-1 Size 70 Preparation Of Autocad Drawing With Colour Print For Building / Bridge / Road / Cd Works In Required Sizeetc. Complete. A-2 Size 71 Autocaddrawingwithcolourprintoutfor Building / Bridge / Road / Cdworksinrequiredsizeetc.Complete. A-0 Size 72 Autocaddrawingwithcolourprintoutfor Building / Bridge / Road / Cdworksinrequiredsizeetc.Complete. A-1 Size 73 Autocaddrawingwithcolourprintoutfor Building / Bridge / Road / Cdworksinrequiredsizeetc.Complete. A-2 Size 74 Autocaddrawingwithcolourprintoutfor Building / Bridge / Road / Cdworksinrequiredsizeetc.Complete. A-3 Size 75 Autocaddrawingwithcolourprintoutfor Building / Bridge / Road / Cdworksinrequiredsizeetc.Complete. A-4 Size 76 Deployingautomatedtrafficcountandclassificationsystemonroad ( Twolane ) Inbothdirectionat Designatedtraffic Count Post By Using High Definitioncameras..Collecting The Non Editable Data Indvr System With Necessary Electronic And Electrical Arrangements Or Inventor Of Required Capacity Classification Of Dataaspervehiclecategoryasrequiredwiththehelpofsoftwareandsubmittingthethereportstothe Concerned Department In Hard Copies As Well As In Soft Copy, Including Using Necessary Technical Manpower Etc. Complete.A ) U T 7 D ( Tl ) 77 Deployingautomatedtrafficcountandclassificationsystemonroad ( Onelane ) Inbothdirectionat Designatedtraffic Count Post By Using High Definitioncameras..Collecting The Non Editable Data Indvr System With Necessary Electronic And Electrical Arrangements Or Inventor Of Required Capacity Classification Of Dataaspervehiclecategoryasrequiredwiththehelpofsoftwareandsubmittingthethereportstothe Concerned Department In Hard Copies As Well As In Soft Copy, Including Using Necessary Technical Manpower Etc. Complete.B ) Ethfdditil L ( Ifi D ) 78 Providing Of Jeep / Vehicle For Conveying Surey Material, Engineers, Labours Etc. Complete 79 Cutting Down Trees Including Trunks And Branches With Girths Above 30Cm To 60Cm And Stacking The Materials Neatly With All Lifts And Lead Of 1000M As Directed And Earth Filling In The Depression / Pit If Any. 80 Cutting Down Trees Including Trunks And Branches With Girths Above 60Cm To 90Cm And Stacking The Materials Neatly With All Lifts And Lead Of 1000M. As Directed And Earth Filling In The Depression / Pit If Any. 81 Cuttingdowntreesincludingtrunksandbrancheswithgirthsabove90cmto180cmandstackingthe Materials Neatly With All Lifts And Lead Of 1000M. As Directed And Earth Filling In The Depression / Pit If Any. 82 Cuttingdowntreesincludingtrunksandbrancheswithgirthsabove180cmto270cmandstackingthe Materials Neatly With All Lifts And Lead Of 1000M. As Directed And Earth Filling In The Depression / Pit If Any. 83 Cuttingdowntreesincludingtrunksandbrancheswithgirthsabove270cmto450cmandstackingthe Materials Neatly With All Lifts And Lead Of 1000M. As Directed And Earth Filling In The Depression / Pit If Any. 84 Cutting Down Trees Including Trunks And Branches With Girths Above 450Cm And Stacking The Materials Neatly With All Lifts And Lead Of 1000M. As Directed And Earth Filling In The Depression / Pit If Any. 85 Clearing Grass And Removal Of Rubbish Up To A Distance Of 50 Metres Outside The Periphery Of The Area . 86 Clearing And Grubbing Road Land Including Uprooting Rank Vegetation, Grass, Bushes, Shrubs, Saplings And Trees Girthupto300mm, Removalofstumpsoftreescutearlieranddisposalofunserviceablematerialsand Stacking Of Serviceable Material To Be Used Or Auctioned Up To A Lead Of 1000 Metres Including Removal And Disposal Of Top Organic Soil Not Exceeding 150 Mm In Thickness. 87 Excavation For Roadway In Earth, Soil Of All Sorts, Sand, Gravel Or Soft Murum Including Dressing Section To The Requiredgrade, Camberandside Slopesandconveying The Excavatedmaterialswithallliftsuptoaleadof 50M.Andspreadingforembankmentorstackingasdirected.Bymanualmeans. ( Itemusedonlywhenquantit Is Below 10 Cu.M. ) 88 Excavation For Roadway In Earth, Soil Of All Sorts, Sand, Gravel Or Soft Murum Including Dressing Section To The Requiredgrade, Camberandside Slopesandconveying The Excavatedmaterialswithallliftsuptoaleadof50m. And Spreading For Embankment Or Stacking As Directed. 89 Excavation For Roadway In Hard Murum And Boulder Including Dressing Section To The Required Grade, Camber Andsideslopesandconveyingtheexcavatedmaterialswithallliftsuptoaleadof50m.Andspreadingforembankment Or Stacking As Directed. 90 Excavation For Roadway In Soft Rock, Including Dressing Section To The Required Grade, Camber And Side Slopes And Conveying The Excavated Materials With All Lifts Upto A Lead Of 50M. And Spreading Or Stacking As Directed. 91 Excavation For Roadway In Hard Rock By Controlled Blasting Including Dressing Section To The Required Grade, Camber And Side Slopes And Conveying The Excavated Materials With All Lifts Upto A Lead Of 50M. And Spreadingfor Embankment Or Stocking As Directed 92 Excavation For Roadway In Hard Rock By Wedging And Chiselling Or Line Drilling Including Dressing Section To The Required Grade, Camber And Side Slopes And Conveying The Excavated Materials With All Lifts Upto A Lead Of50m. And Spreading For Embankment Or Stacking As Directed. 93 Excavationforcatch / Side Watergutterinallsortsofsoilstothespecifiedsectionincluding Stackingthe Excavated Stuff In A Regular Bund And Disposing Of Unsuitable Or Excess Stuff As Directed All Sorts Of Soils. 94 Excavation For Catch / Side Water Gutter In Hard Murum And Boulder Strata To The Specified Section Including Stacking The Excavated Stuff In A Regular Bund And Disposing Of Unsuitable Or Excess Stuff As Directed. 95 Excavationforcatch / Sidewatergutterinsoftrockstratatothespecifiedsectionincludingstackingthe Excavated Stuff In A Regular Bund And Disposing Of Unsuitable Or Excess Stuff As Directed. 96 Excavation For Catch / Side Water Gutters Inhard Rock Strata To The Specified Section Including Stacking Theexcavatedstuff Ina Regular Bundby Chiselling Andwedging Anddisposing Of Unsuitable Or Excess Stuff As Directed 97 Watering And Compacting Of Embankment Formed Of Materials Obtained From The Road Cutting Within A Lead Of50m, Not Less Than97%Of Standardproctor Density After Laying Them Inlayers Of 20Cm. To 30 Cm. With Vibratory Roller 98 Watering And Compacting Of Embankment Formed Of Materials Obtained From The Road Cutting Within A Lead Of 50M, Notlessthan97%Ofstandardproctordensityafterlaying Them Inlayersof20cm.To30cm.Withpower Roller. 99 Conveying Materials Obtained From Road Cutting Including All Lifts, Laying In Layers Of 20Cm To 30Cm. Breaking Clods, Dressing To The Required Lines, Curves, Grades And Section, Watering And Compacting To Not Less Than 97% Of Standard Proctor Density For A Lead Of Over 50M. To 300M. Inclusive From The Site Of Excavation To The Site Ofdeposition As Directed. 100 Conveying Materials Obtained From Road Cutting Including All Lifts, Laying In Layers Of 20Cm. To 30Cm. Breaking Clods, Dressing To The Required Lines, Curves, Grades And Section, Watering And Compacting To Not Less Than 97% Of Standard Proctor Density For A Lead Of 300M. To 500M. Inclusive, From The Site Of Excavation To The Site Ofdeposition As Directed 101 Providing Earth Work In Embankment With Approved Materials Obtained From Departmental Land Upto Lead Of 50M. Including All Lifts, Laying In Layers Of 20Cm. To 30Cm. Thickness Breaking Clods, Dressing To The Required Lines, Curves, Grades & Section, Watering And Compaction With Vibratory Roller To Achieve Not Less Than 97 % Of Standard Proctor Density Etc. Complete ( Material Obtained From Departmental Land ) 102 Providing Earth Work In Embankment With Approved Materials Obtained From Other Sources Upto Lead Of 50M. Including All Lifts, Laying In Layers Of 20Cm. To 30Cm. Thickness Breaking Clods, Dressing To The Required Lines, Curves, Grades & Section, Watering And Compaction With Vibratory Roller With V-Sat Attachment To Achieve Not Less Than 97 % Of Standard Proctor Density Etc. Complete ( Material Obtained From Other Sources ) 103 Supplying Hard Murum / Kankar At The Road Siteincluding Conveying And Stacking Complete. 104 Supplying Soft Murum At The Road Siteincluding Conveying And Stacking Complete. 105 Spreading Hard Murum / Soft Murrum / Gravel Or Kankar For Side Width Complete 106 Compactingthehardmurumsidewidthsincludinglayinginlayersoneachsidewithvibratoryrollerincluding Artificial Watering Etc. Complete. 107 Picking The Road Surface Including Sectioning Etc. Complete ( Wbm Surface. ) 108 Picking The Road Surface Including Sectioning Etc. Complete ( Bt Surface. ) 109 Providing Dry Rubble Stonepitching 23 Cm ( About 9 ) Thick Including All Material, Quarry Spalls, Labour Etc.Complete 110 Providing, Laying And Spreading Soil On A Prepared Sub Grade, Pulverizing, Mixing The Spread Soil In Place With Rotavator With 3 Per Cent Slaked Lime With Minimum Content Of 70 Per Cent Of Cao, Grading With Motor Grader And Compacting With The Road Roller At Omc To Achieve Atleast 98 Per Cent Of The Max Dry Density To Form Alayer Of Sub Base. 111 Providing, Laying Andspreading Soil Ona Preparedsubgrade, Pulverizing, Adding The Designedquantityof Cement To The Spread Soil, Mixing In Place With Rotavator, Grading With The Motor Grader And Compacting With The Roadrollerat Omcto Achieve The Desiredunconfinedcompressive Strengthandto Form A Layerof Sub-Base / Base. 112 Laying And Spreading Available Soil In The Sub-Grade On A Prepared Surface, Pulverizing, Mixing The Spread Soil In Place With Rotavator With 3 Per Cent Slaked Lime Having Minimum Content Of 70 Per Cent Of Cao, Grading Withmotorgraderandcompactingwiththeroadrolleratomctothedesireddensitytoformalayerofimproved Sub Grade 113 Construction Of Embankment With Flyash Conforming To Table 1 Of Irc: Sp: 58 - 2001 Obtained From Coal Or Lignite Burning Thermal Power Stations As Waste Material, Spread And Compacted In Layer Of 200Mm Thickness Each At Omc, All As Specified In Irc: Sp: 58-2001 And As Per Approved Plans. 114 Construction Of Granular Sub-Base By Providing Close Graded Material, Mixing In A Mechanical Mix Plant At Omc, Carriageofmixedmaterialtoworksite, Spreadinginuniformlayerswithmotorgrader / Paveron Prepared Surface And Compacting With Vibratory Roller To Achieve The Desired Density, Complete As Per Clause401 -- Plant Mix Method And Grading - I Material 115 Construction Of Granular Sub-Base By Providing Close Graded Material, Mixing In A Mechanical Mix Plant At Omc, Carriageofmixedmaterialtoworksite, Spreadinginuniformlayerswithmotorgrader / Paveron Prepared Surface And Compacting With Vibratory Roller To Achieve The Desired Density, Complete As Per Clause401 -- Plant Mix Method And Grading - Ii Material 116 Construction Of Granular Sub-Base By Providing Close Graded Material, Mixing In A Mechanical Mix Plant At Omc, Carriageofmixedmaterialtoworksite, Spreadinginuniformlayerswithmotorgrader / Paveron Prepared Surface And Compacting With Vibratory Roller To Achieve The Desired Density, Complete As Per Clause401-- Plt Mix Methd D G Di - Iii Mat Il 117 Construction Of Granular Sub-Base By Providing Close Graded Material, Spreading In Uniform Layers With Motor Grader / Paveron Prepared Surface, Mixing By Mix In Place Method With Rotavator At Omc, And Compacting With Vibratory Roller To Achieve The Desired Density, Complete As Per Clause 401 -- By Mix In Place Method Andgrading - I Material 118 Construction Of Granular Sub-Base By Providing Close Graded Material, Spreading In Uniform Layers With Motor Grader / Paver On Prepared Surface, Mixing By Mix In Place Method With Rotavator At Omc, And Compacting With Vibratory Roller To Achieve The Desired Density, Complete As Per Clause 401 -- By Mix In Place Method Andgrading - Ii Material 119 Construction Of Granular Sub-Base By Providing Close Graded Material, Spreading In Uniform Layers With Motor Grader / Paver On Prepared Surface, Mixing By Mix In Place Method With Rotavator At Omc, And Compacting With Vibratory Roller To Achieve The Desired Density, Complete As Per Clause 401 -- By Mix In Place Method Andgrading - Iii Material 120 Lime, Flyashstabilizedsoilsub-Base--Constructionofsub-Baseusinglime-Flyashadmixturewith Granular Soil, Free From Organic Matter / Deleterious Material Or Clayey Silts And Low Plasticity Clays Having Pi Between 5 And 20 And Liquid Limit Less Than 25 And Commercial Dry Lime, Slaked At Site Or Pre-Slaked With Cao Content Not Less Than 50 Per Cent, Fly Ash To Conform To Gradation As Per Clause 4.3 Of Irc: 88-1984, Lime + Fly Ash Content Ranging Between 10 To 30 Per Cent, The Minimum Un-Confined Compressive Strength And Cbr Value After 28 Days Curing And 4 Days Soaking To Be 7.5Kg / Sq, Cm And 25 Per Cent Respectively, All As Specified In Irc: 88-1984. 121 Cementtreatedcrushedrockorcombinationasperclause403.2Andtable400.4Insubbase / Base-- Providing, Laying And Spreading Material On A Prepared Sub Grade, Adding The Designed Quantity Of Cement To The Spread Material, Mixing In Place With Rotavator, Grading With The Motor Grader And Compacting With The Roadrolleratomctoachievethedesiredunconfinedcompressivestrengthandtoformalayerofsub- Base / Base Course. A ) For Sub-Base Course 122 Cementtreatedcrushedrockorcombinationasperclause403.2Andtable400.4Insubbase / Base-- Providing, Laying And Spreading Material On A Prepared Sub Grade, Adding The Designed Quantity Of Cement To The Spread Material, Mixing In Place With Rotavator, Grading With The Motor Grader And Compacting With The Roadrolleratomctoachievethedesiredunconfinedcompressivestrengthandtoformalayerofsub- Base / Base Course. B ) For Base Course 123 Scarifying The Existing Granular Road Surface To A Depth Of 50 Mmand Disposal Of Scarified Material Within Alllifts And Leads Upto 1000 Metres 124 Dismantling Of Flexible Pavements And Disposal Of Dismantled Materials Up To A Lead Of 1000 Metres, Stackingserviceable And Unserviceable Materials Separately Etc. Complete. 125 Dismantling Of Cement Concrete Pavement By Mechanical Means Using Pneumatic Tools, Breaking To Pieces Not Exceeding 0.02 Cum In Volume And Stock Piling At Designated Locations And Disposal Of Dismantled Materials Up To A Lead Of 1000 Metres, Stacking Serviceable And Unserviceable Materials Separately Etc. Complete. 126 Making 50Mm X25mm Furrows, 45Degree To The Center Line Of The Roadand At One Metre Interval Inthe Existing Thin Bituminous Wearing Coarse Including Sweeping And Disposal Of Excavated Material Within 1000Metres Lead 127 Making 50Mm X50mm Furrows, 45Degree To The Center Line Of The Roadand At One Metre Interval Inthe Existing Thin Bituminous Wearing Coarse Including Sweeping And Disposal Of Excavated Material Within 1000Metres Lead 128 Broomingthew.B.M.Surfacebywirebrushes, Coirbrushers, Dusting, Cleaningetc.Forreceivingthebituminous Treatment Complete. Brooming The Water Bound Macadam Surface By Wire. 129 Providing, Laying, Spreadingandcompactingstoneaggregatesofspecificsizestowaterboundmacadam Specification Including Spreading In Uniform Thickness, Hand Packing To Proper Grade And Camber, Applying Andbroomingrequisitetypeofscreening / Bindingmaterialstofilluptheintersticesofcoarseaggregate, Watering And Compacting With Vibratory Roller. To The Requireddensity. By Mechanical Means - Grading I ( Using Screening Type A ( 13.2 ) Mm Aggregate ) 130 Providing, Laying, Spreadingandcompactingstoneaggregatesofspecificsizestowaterboundmacadam Specification Including Spreading In Uniform Thickness, Hand Packing To Proper Grade And Camber, Applying Andbroomingrequisitetypeofscreening / Bindingmaterialstofilluptheintersticesofcoarseaggregate, Wateringandcompactingwithvibratoryrollertotherequireddensity.Bymechanicalmeans-Grading I ( Using Screening Typ B ( 11 2 Mm ) Aggregate ) 131 Providing, Laying, Spreadingandcompactingstoneaggregatesofspecificsizestowaterboundmacadam Specification Including Spreading In Uniform Thickness, Hand Packing To Proper Grade And Camber, Applying Andbroomingrequisitetypeofscreening / Bindingmaterialstofilluptheintersticesofcoarseaggregate, Watering Andcompacting Withvibratory Roller To The Requireddensity. Bymechanical Means- Grading Ii ( Ui S I T B ( 11 2 ) A T ) 132 Crushed Cement Concrete Sub-Base / Base - Breaking And Crushing Of Material Obtained By Breaking Damaged Cementconcreteslabstosizerangenotexceeding75mmasspecifiedintable400.7Transportingthe Aggregates Obtainedfrom Breaking Of Cement Concrete Slabs At A Leadof1km., Laying And Compacting The Same Assubbase / Base Course, Constructedaswbmtoclause 404Exceptthe Use Ofscreening Orbindingmaterial. 133 Penetration Coat Over Top Layer Of Crushed Cement Concrete Base -- Spraying Of Bitumen Over Cleaned Dry Surface Of Crushed Cement Concrete Base At The Rate Of 25Kg Per 10 Sqm By A Bitumen Pressure Distributor, Spreading Of Key Aggregates At The Rate Of 0.13 Cum Per 10 Sqm By A Mechanical Gritter And Rolling The Surfaceas Per Clause 506.3.8 134 Wetmixmacadam--Providing, Laying, Spreadingandcompactinggradedstoneaggregatetowetmix Macadam Specification Including Premixing The Material With Water At Omc In Mechanical Mix Plant Carriage Of Mixedmaterial By Tipper To Site, Laying Inuniform Layers Withpaver Insub- Base / Base Course Onwell Prepared Surface And Compacting With Vibratory Roller To Achieve The Desired Density. Laying By Grader / Paver. 135 Crusherrunmacadambase--Providingcrushedstoneaggregate, Depositingonapreparedsurfaceby Hauling Vehicles, Spreading And Mixing With A Motor Grader, Watering And Compacting With A Vibratory Roller To Clause 410 To Form A Layer Of Sub-Base / Base -- By Mix In Place Method For 53 Mm Maximum Size 136 Crusherrunmacadambase--Providingcrushedstoneaggregate, Depositingonapreparedsurfaceby Hauling Vehicles, Spreading And Mixing With A Motor Grader, Watering And Compacting With A Vibratory Roller To Clause 410 To Form A Layer Of Sub-Base / Base -- By Mix In Place Method For 45 Mm Maximum Size 137 Crusherrunmacadambase--Providingcrushedstoneaggregate, Depositingonapreparedsurfaceby Hauling Vehicles, Spreading And Mixing With A Motor Grader, Watering And Compacting With A Vibratory Roller To Clause 410 To Form A Layer Of Sub-Base / Base -- By Mixing Plant Method For 53 Mm Maximum Size 138 Crusherrunmacadambase--Providingcrushedstoneaggregate, Depositingonapreparedsurfaceby Hauling Vehicles, Spreading And Mixing With A Motor Grader, Watering And Compacting With A Vibratory Roller To Clause 410 To Form A Layer Of Sub-Base / Base -- By Mixing Plant Method For 45 Mm Maximum Size 139 Dismantling Of Existing B.T. Surface ( Flexible Pavement ) To A Depth Of 50 Mm. Manually Including Loading Ofdismantled Material To Transport Vehicle At Site Excluding Lead Charges 140 Prime Coat - Providing And Applying Primer Coat With Bitumen Emulsion On Prepared Surface Of Granular Base Including Cleaning Ofroad Surface And Spraying, Primer At The Rate Of 0.60 Kg / Sqm Using Mechanical Means. 141 Providing And Applying Tack Coat On The Prepared Surface Heating By Fames In Boiler And Spraying Bitumen Set Footed In Bitumen Boller On B.T. Surface 2.5 Kg / 10 Sqm. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive Atrates ) 142 Providing And Applying Tack Coat On The Prepared Surface Heating By Fames In Boiler And Spraying Bitumen With Sprayer On Dry / Hungry B.T. Surface 3 Kg / 10 Sqm. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive Atrates ) 143 Providing And Applying Tack Coat On The Prepared Surface Heating By Flames In Boiler And Spraying Bitumenwithsprayerongranularsurfacetreatedwithprimer@2.75Kg / 10Sqm ( Vg-30Bulkbitumenratesare Considered To Arrive At Rates ) 144 Providing And Applying Tack Coat On The Prepared Surface Heating By Flames In Boiler And Spraying Bitumen Withsprayeronconcretesurfacetreatedwithprimer@3.25Kg / 10Sqm ( Vg-30Bulkbitumenratesareconsidered To Arrive At Rates ) 145 Providing And Applying Tack Coat With Bitumen Emulsion ( Rs1 ) Using Emulsion Pressure Distributer At The Rate Of 0.20 Kg Per Sq.M. On The Prepared Bituminous Cleaned With Mechanical Broom 146 Providing And Constructing 75 Mm. Thick Modifiedpenetration Macadam ( Mpm ) Road Surface Including All Materials, Preparing The Existing Road Surface, Spreading 40 Mm. Stone Metal Layers 30% Crusher Broken Metal+ 70% Hand Broken ( By Breaking Rubbleobtained By Blasting ) Heating And Spraying Thebitumen Of Specified Grade @ 2 Kg / Sqm, Spreading 12 Mm.Size Chips Compacting With Three Wheel Static Roller Having Weight 8 To 10 Mt. To Achive The Desired Degree Of Compaction As Per Technical Specification Clause 506 Etc. Complete. Including Picking Of Existing Wbm Surface. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 147 Providing And Constructing 75 Mm. Thick Modifiedpenetration Macadam ( Mpm ) Road Surface Including All Materials, Preparingtheexistingroadsurface, Spreading40mm.Stonemetallayers100%Crusherbroken Metal With Conical Crusher Plant Heating And Spraying Thebitumen Of Specified Grade @ 2 Kg / Sqm, Spreading 12 Mm.Size Chips Compacting With Three Wheel Static Roller Having Weight 8 To 10 Mt. To Achive The Desired Degree Of Compaction As Per Technical Specification Clause 506 Etc. Complete.Including Picking Of Existing Wbm Surface. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 148 Providing And Constructing 75 Mm. Thick Modifiedpenetraction Macadam ( Mpm ) Road Surface Including All Materials, Preparing The Existing Road Surface, Spreading 40 Mm. Stone Layers Metal 30%Crusher Broken Metal+ 70% Hand Broken Metal ( By Breaking Rubble Obtained By Blasting ) , Heating And Spraying Thebitumen Of Specified Grade @ 2 Kg / Sqm , Spreading 12Mm.Size Chips Compacting With Three Wheel Static Roller Having Weight 8To 10Mt. To Achive The Desireddegree Ofcompactionasper Technicalspecificationclause 506 Etc.Complete, Includingapplyingtackcoatofspecifiedgradeofbitumenattherateof0.30Kgsqm.On Existing Bitumen Surface. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 149 Providing And Constructing 75 Mm. Thick Modifiedpenetraction Macadam ( Mpm ) Road Surface Including All Materials, Preparingtheexistingroadsurface, Spreading40mm.Stonelayersmetal100% Crusherbroken Metalwithconicalcrusherplant , Heatingandsprayingthe Bitumenofspecifiedgrade@2Kg / Sqm, Spreading 12Mm.Size Chips Compacting With Three Wheel Static Roller Having Weight 8 To 10 Mt. To Achive The Desired Degree Of Compaction As Per Technical Specification Clause 506 Etc.Complete, Including Applying Tack Coatofspecifiedgradeofbitumenattherate Of0.30Kgsqm.Onexisting Bitumensurface. ( Vg-30Bulk Bitumen Rates Are Considered To Arrive At Rates ) 150 Providing And Constructing 50 Mm. Thick Modifiedpenetration Macadam ( Mpm ) Road Surface Including All Mataerials, Preparing The Existing Road Surface, Spreading 40Mm. Stone Metal Layers 30% Crusher Broken Metal+ 70% Hand Broken ( By Breaking Rubbleobtained By Blasting ) Heating And Spraying Thebitumen Of Specified Grade @ 1.75 Kg / Sqm, Spreading 12Mm.Size Chips Compacting Withstatic Roller Having Weight 8 To 10 Mt. To Achive The Desired Degree Of Compaction As Per Technical Specification Clause 506Etc. Complete.Including Picking Of Existing Wbm Surface. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 151 Providing And Constructing 50 Mm. Thick Modifiedpenetration Macadam ( Mpm ) Road Surface Including All Mataerials, Preparingtheexistingroadsurface, Spreading40mm.Stonemetallayers100%Crusherbroken Metalwithconicalcrusherplantheatingandsprayingthe Bitumenofspecifiedgrade@1.75Kg / Sqm, Spreading 12Mm.Size Chips Compacting With Staticroller Having Weight 8To 10Mt. Toachive The Desired Degree Of Compaction As Per Technical Specification Clause 506Etc. Complete.Including Picking Of Existing Wbm Surface. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 152 Providing And Constructing 50 Mm. Thickmodifiedpenetration Macadam ( Mpm ) Road Surface Including All Materials, Preparing The Existing Road Surface, Spreading 40Mm. Stone Layers Metal 30%Crusher Broken Metal+ 70% Hand Broken Metal ( By Breaking Rubble Obtained By Blasting ) , Heating And Spraying The Bitumen Of Specified Grade @ 1.75 Kg / Sqm, Spreading 12Mm.Size Chips Compacting With Static Roller Having Weight 8 To 10 Mt. To Achive The Desired Degree Of Compaction As Per Technical Specification Clause 506 Etc.Complete, Including Applying Tack Coat Of Bitumen 0F Specified Grade At The Rate Of 0.30 Kg Sqm. ( On Existing Bitumenf ) 153 Providing And Constructing 50 Mm. Thickmodifiedpenetration Macadam ( Mpm ) Road Surface Including All Materials, Preparingtheexistingroadsurface, Spreading40mm.Stonelayersmetal100% Crusherbroken Metalwithconicalcrusherpalnt, Heatingandsprayingthebitumenofspecifiedgrade@1.75Kg / Sqm, Spreading 12Mm.Size Chipscompacting Withstaticrollerhaving Weight8to 10Mt. Toachive The Desired Degree Of Compaction As Per Technical Specification Clause 506 Etc.Complete, Including Applying Tack Coat At The Rate Of 0.30 Kg Sqm.On Existing Bitumen Surface. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive Att ) 154 Providing, Laying And Compacting Of Built-Up-Spray Grout Layer 75 Mm Thick Over Prepared Base Consisting Of Two Layers Composite Constructionof Compactedcrushedcoarse Aggregates Withapplicationof Bituminous Binderofbiyumenofspecifiedgrade@1.520Kg / Sqmaftereachlayer, ( I.E1.520X2=3.04Say3.00 Kg / Sqm ) And With Key Aggregates Placed On Top Of The Second Layer And Compacting With Static Roller 8 To 10 Mt. Excluding Cost Of Tack Coat Andscarifying Etc. Complete. ( Vg-30 Bulk Bitumen Rates Are Considered Toi Tt ) 155 Bituminous Macadam: Proving And Laying Bituminous Macadam Using Crushed Aggregates Of Grading 1, Premixed With Bituminous Binder, Transported To Site With Vts , Laid Over A Previously Prepared Surface, Finished To The Required Grade, Level, Alignment, And Rolling To Achieve The Desired Compaction For 80 / 100 Mm Compacted Thickness With 3.3 % Using Specified Grade Of Bitumen. -- Using Batch Mix Type Hot Mix Plant With Scada, Sensor Paver, Vibratory Roller. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 156 Bituminousmacadam:--Providingandlayingbituminousmacadamusingcrushedaggregateof Grading 1, Premixed With Bituminous Binder, Transported At Site With Vts, Laid Over A Previously Prepared Surface , Finished To The Required Grade , Level, Alignment, And Rolling To Achieve The Desired Density For 80 / 100 Mm Compacted Thickness With Drum Mix Type Hot Mix Plant With Scada Having Complying Essential Features Ofhotmixplantasperirc-272009Specifiedconditionsandattachmentssuchaselectronicloadsensor Basedbeltconveyers, Automaticsynchronizationofbitumenandaggregatefedder, Builtindustcontroller Systemandplcfordrummixplant, Sensorpaver, Andvibratoryrollerexcludingprime / Tackcoatetc. Complete --Bitumen3.30% Of Specified Grade ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 157 Densebituminousmacadam:Provingandlayingdensebituminousmacadamusingcrushed Aggregates Of Grading 1, Premixed With Bituminous Binder Of Specified Grade Of Bitumen @ 4.50 Per Cent By Weight Of Total Mix And Filler, Transported To Site With Vts , Laid Over A Previously Prepared Surface, Finished To The Required Grade, Level, Alignment, And Rolling To Achieve The Desired Density For 76-100 Mm Compacted Thickness.Usingbatchmixtypehotmixplantwithscada, Sensorpaver, Vibratoryrollerwithstone Dust Filler. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 158 Densebituminousmacadam:--Providingandlayingdensebituminousmacadamusingcrushed Aggregate Of Grading 1, Premixed With Bituminous Binder Bitumen Of Specified Grade, @ 4.50 % By Weight Of Totalmixandfiller, Transportedatsite Withvts, Laidoverapreviouslypreparedsurface , Finishedtothe Required Grade , Level, Alignment, And Rolling To Achieve The Desired Density For 76 / 100 Mm Compacted Thickness With Drum Mix Type Hot Mix Plant With Scada Having Complying Essential Features Of Hot Mix Plant As Per Irc-27-2009Specifiedconditionsandattachmentssuchaselectronicloadsensorbasedbeltconveyers, Automatic Synchronization Of Bitumen And Aggregate Fedder, Built In Dust Controller System And Plc For Drum Mixplant, Sensorpaver, Andvibratoryrollerexcludingprime / Tackcoatetc.Complete--Bitumenvg-30 Grade With Stone Dust Filler ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 159 Bituminous Concrete:- Providing And Laying Bituminous Concrete Using Crushed Aggregates Of Grading 1, Premixed With Bituminous Binder @ 5.20 Per Cent By Weight Of Total Mix And Filler, Transported To Site With Vts , Laid Over A Previously Prepared Surface, Finished To The Required Grade, Level, Alignment, And Rolling To Achieve The Desired Compactionfor 50 Mm Compacted Thickness With Specified Grade Of Bitumen, Excluding Prime / Tackcoat.Forbitumenofspecifiedgrade --Usingbatchmixtypehotmixplantwithscada, Sensor Paver, Vibratory Roller With Stone Dust Filler. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive Att ) 160 Bituminous Concrete:--Providing And Laying Bituminous Concrete Using Crushed Aggregate Of Grading 1, Premixed With Bituminous Binder @5.40% By Weight Of Total Mix And Filler, Transported At Site With Vts, Laid Over A Previously Prepared Surface, Finished To The Required Grade , Level, Alignment, And Rolling To Achieve Thedesireddensityfor50mmcompactedthicknesswithdrummixplantwithscada, Sensorpaverand Vibratory Roller Excluding Prime / Tack Coat Etc. Complete --Bitumen Of Specified Grade With Stone Dust Filler. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 161 Providing Bituminous Type Aliquidseal Coat Onbituminous Surface Including Supplying All Materialsand Bitumen Of Specified Gradepreparing Existing Road Surface, Heating And Applying Bitumen @ 0.98 Kgsqm. By Mechanical Means, Spreading Chips And Rolling, By Static Roller Having Weight 8 To 10 Mt. Etc. Complete. ( Vg- 30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 162 Providing And Laying Of Type - B Premix Seal Coat With Hmp Of Appropratecrushed Stone Chipping 6.70 Mm Size And Penetration Bitumen Of Specified Grade @ 0.68 Kg / Sqm. , Preparing Existing Road Surface Including Mixing In Suitable Batch Mixplant And Rolling Bystatic Roller Having Weight 8 To 10 Mt. Etc. Complete. ( Vg- 30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 163 Surface Dressing -- Providing And Laying Surface Dressing As Wearing Course In Single Coat Using Crushed Stone Aggregates Of Specified Size On A Layer Of Bituminous Binder Laidon Preparedsurface Androlling With8-10 Tonne Smooth Wheeled Steel Roller. --A ) 19 Mm Nominal Chippling Size ( Bitumen 12.00 Kg / 10 Sq.M. ) -- Bitumen Of Specified Grade ( Vg-30 Bulkbitumen Rates Are Considered To Arrive At Rates ) 164 Surface Dressing -- Providing And Laying Surface Dressing As Wearing Course In Single Coat Using Crushed Stone Aggregates Of Specified Size On A Layer Of Bituminous Binder Laidon Preparedsurface Androlling With8-10 Tonne Smooth Wheeled Steel Roller. --B ) 13Mm Nominalchippling Size ( Bitumen10.00Kg / 10Sq.M--Bitumenofspecifiedgrade ( Vg-30Bulkbit Tid D Ti Tt ) 165 Surface Dressing -- Providing And Laying Surface Dressing As Wearing Course In Single Coat Using Crushed Stone Aggregates Of Specified Size On A Layer Of Bituminous Binder Laidon Preparedsurface Androlling With8-10 Tonne Smooth Wheeled Steel Roller. --C ) 10Mmnominalchipplingsize ( Bitumen9.0Kg / 10Sq.M--Bitumenofspecifiedgrade ( Vg-30Bulkbitumen Rates Are Considered To Arrive At Rates ) 166 Surface Dressing -- Providing And Laying Surface Dressing As Wearing Course In Single Coat Using Crushed Stone Aggregates Of Specified Size On A Layer Of Bituminous Binder Laidon Preparedsurface Androlling With8-10 Tonne Smooth Wheeled Steel Roller. --D ) 6Mmnominalchipplingsize ( Bitumen7.50Kg / 10Sq.M--Bitumenofspecifiedgrade ( Vg-30Bulkbitumn Rates Are Considerd To Arrive At Rates ) 167 Open Graded Premix Surfacing- Providing And Laying Ogc 20 Mm Thickness Composed Of 13.2 Mm To 5.6 Mmaggregatespremixedwithbituminousbindertransportedtositewithvts, Laidoverapreviously Preparedsurface, Finishedtotherequiredgrade, Level, Alignment, Androllingtoachievethedesired Compaction But Excluding Prime / Tack And Seal Coat. For Bitumen Of Specified Grade--Using Drum Mix Type Hotmixplantwithscada, Paverandvibratoryroller ( Overbtsurface ) ( Vg-30Bulkbitumenratesareid D Ti Tt ) 168 Open Graded Premix Surfacing- Providing And Laying Ogc 20 Mm Thickness Composed Of 13.2 Mm To 5.6 Mmaggregatespremixedwithbituminousbindertransportedtositewithvts, Laidoverapreviously Preparedsurface, Finishedtotherequiredgrade, Level, Alignment, Androllingtoachievethedesired Compaction But Excluding Prime / Tack And Seal Coat. For Bitumen Of Specified Grade--Using Drum Mix Type Hot Mix Plant With Scada, Paver And Vibratory Roller ( Over Mpm Surface ) ( Vg-30 Bulk Bitumen Rates Areonidred To Arrive At Rate ) 169 9 Mm Seal Coat: Providing And Laying Of Type A 9Mm Premix Seal Coat With Hmp Of Apropriate Capacity Crushedstonechiping6.7Mmsizeandpenetrationbitumenofspecifiedgrade@1.2Kg / Sq.M, Preparing Existing Road Surface By Mechanical Means, Spreading Chips And Rolling, By Static Roller Having Weight 8 To 10 Mt. Etc. Complete. ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 170 Providing And Laying In-Situm30 Grade Unreinforced Plain Cement Concretepavementover A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification2013, Mixedinabatchingandmixingplant / Nontiltingmixerandweighbatcher Asper Approved Mix Design, Admixtures, Transporting To Site, Spreading, Laying With Approved Make Paver, Compacted And Finished In A Continuous Operation, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring 80 Mm At Bottom And 40 Mm At Top Withdepth Of 75Mm And Maintaining The Same Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 171 Providing And Laying In-Situm35 Grade Unreinforced Plain Cement Concretepavementover A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification2013, Mixedinabatchingandmixingplant / Nontiltingmixerandweighbatcher Asper Approved Mix Design, Admixtures, Transporting To Site, Spreading, Laying With Approved Make Paver, Compacted And Finished In A Continuous Operation, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring 80 Mm At Bottom And 40 Mm At Top Withdepth Of 75Mm And Maintaining The Same Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 172 Providing And Laying In-Situm40 Grade Unreinforced Plain Cement Concretepavementover A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification2013, Mixedinabatchingandmixingplant / Nontiltingmixerandweighbatcher Asper Approved Mix Design, Admixtures, Transporting To Site, Spreading, Laying With Approved Make Paver, Compacted And Finished In A Continuous Operation, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring 80 Mm At Bottom And 40 Mm At Top Withdepth Of 75Mm And Maintaining The Same Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 173 Providing And Laying In-Situm30 Grade Unreinforced Plain Cement Concretepavementover A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification2013, Mixedinatiltingtypeconcretemixerasperapprovedmixdesign, Admixtures, Spreading, Laying Compacting And Finished In A Continuous Operation Without Paver Machine, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring 80 Mm At Bottom And 40 Mm At Top With Depthof75mmandmaintainingthesamethroughoutcuringperiodbyanyothermethodapprovedby Engineer-In-Charge. 174 Providing And Laying In-Situm35 Grade Unreinforced Plain Cement Concretepavementover A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification2013, Mixedinatiltingtypeconcretemixerasperapprovedmixdesign, Admixtures, Spreading, Laying Compacting And Finished In A Continuous Operation Without Paver Machine, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring 80 Mm At Bottom And 40 Mm At Top With Depthof75mmandmaintainingthesamethroughoutcuringperiodbyanyothermethodapprovedby Engineer-In-Charge. 175 Providing And Laying In-Situm40 Grade Unreinforced Plain Cement Concretepavementover A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification2013, Mixedinatiltingtypeconcretemixerasperapprovedmixdesign, Admixtures, Spreading, Laying Compacting And Finished In A Continuous Operation Without Paver Machine, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring 80 Mm At Bottom And 40 Mm At Top With Depthof75mmandmaintainingthesamethroughoutcuringperiodbyanyothermethodapprovedby Engineer-In-Charge. 176 Providing And Laying In-Situm30 Grade Unreinforced Plain Cement Concretepavementwithmax 20%Fly Ash ( Fly-Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarseaggregatescombinedgradation Aspertable600-3Ofmorthspecification2013, Mixedina Batching Andmixing Plant / Nontilting Mixerandweighbatcher Asperapprovedmixdesign, Admixtures, Transportingtosite, Spreading, Layingwithapprovedmakepaver, Compactedandfinishedinacontinuous Operation, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / Byprovidingcementvataincementmortar1:8@0.6Mx0.6Mcentretocentre, Admeasuring80mmat Bottom And 40 Mm At Top Withdepth Of 75Mm And Maintaining The Same Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 177 Providing And Laying In-Situm35 Grade Unreinforced Plain Cement Concretepavementwithmax 20%Fly Ash ( Fly-Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarseaggregatescombinedgradation Aspertable600-3Ofmorthspecification2013, Mixedina Batching Andmixing Plant / Nontilting Mixerandweighbatcher Asperapprovedmixdesign, Admixtures, Transportingtosite, Spreading, Layingwithapprovedmakepaver, Compactedandfinishedinacontinuous Operation, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / Byprovidingcementvataincementmortar1:8@0.6Mx0.6Mcentretocentre, Admeasuring80mmat Bottom And 40 Mm At Top Withdepth Of 75Mm And Maintaining The Same Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 178 Providing And Laying In-Situm40 Grade Unreinforced Plain Cement Concretepavementwithmax 20%Fly Ash ( Fly-Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarseaggregatescombinedgradation Aspertable600-3Ofmorthspecification2013, Mixedina Batching Andmixing Plant / Nontilting Mixerandweighbatcher Asperapprovedmixdesign, Admixtures, Transportingtosite, Spreading, Layingwithapprovedmakepaver, Compactedandfinishedinacontinuous Operation, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / Byprovidingcementvataincementmortar1:8@0.6Mx0.6Mcentretocentre, Admeasuring80mmat Bottom And 40 Mm At Top Withdepth Of 75Mm And Maintaining The Same Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 179 Providing And Laying In-Situm30 Grade Unreinforced Plain Cement Concretepavementwithmax 20%Fly Ash ( Fly-Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification 2013, Mixed In A Tilting Type Concrete Mixer As Per Approved Mix Design, Admixtures, Spreading, Laying Compacting And Finished In A Continuous Operation Without Paver Machine, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring80mmatbottomand40mm Attopwith Depthof75mmandmaintainingthesame Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 180 Providing And Laying In-Situm35 Grade Unreinforced Plain Cement Concretepavementwithmax 20%Fly Ash ( Fly-Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification 2013, Mixed In A Tilting Type Concrete Mixer As Per Approved Mix Design, Admixtures, Spreading, Laying Compacting And Finished In A Continuous Operation Without Paver Machine, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring80mmatbottomand40mm Attopwith Depthof75mmandmaintainingthesame Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 181 Providing And Laying In-Situm40 Grade Unreinforced Plain Cement Concretepavementwithmax 20%Fly Ash ( Fly-Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base With 43 Grade Cement , Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is 383, Using Fine And Coarse Aggregates Combined Gradationas Per Table 600-3 Of Morth Specification 2013, Mixed In A Tilting Type Concrete Mixer As Per Approved Mix Design, Admixtures, Spreading, Laying Compacting And Finished In A Continuous Operation Without Paver Machine, Finishing To Lines And Gradesas Directed By Engineer-In-Charge And Curingby Curing Compound / By Providing Cement Vata In Cement Mortar 1:8 @0.6M X 0.6M Centre To Centre, Admeasuring80mmatbottomand40mm Attopwith Depthof75mmandmaintainingthesame Throughout Curing Period By Any Other Method Approved By Engineer-In-Charge. 182 Construction Of Dry Lean Cement Concrete Sub- Base Over Aprepared Sub-Gradewith Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Conforming To Is: 383, The Size Of Coarse Aggregate Not Exceeding25mm, , Cementcontentnottobelessthan150kg / Cum, Optimummoisturecontenttobe Determined During Trial Length Construction, Concrete Strength Not To Be Less Than 10 Mpa At 7 Days, Mixed In A Batching Plant / Weigh Batch Mixer, Transported To Site With All Leads And Lifts, Laid With A Paver With Electronic Sensor / By Suitable Means As Approved Byengineer-In-Charge , Compacting Withvibratory Roller, Finishing, Curing Andincluding Preparation Of Sub-Grade Surface If Required Etc. Complete. 183 Providing Andfixing Inpositiontmtfe500, 32Mm Dia Dowel Bars Precoatedwith Anticorrosive Epoxy Paintofrequireddia.60Cms.Longandat30.00Cm.C / Candwhereverdirected Includinghandling, Straightening, Necessary Cutting Supported By Tmt Fe 500, Chairs With Proper Alignment By Using Properly Designed Assembly Of Bulkheads Lubricating Half Length With Bituminous Paint As Directed Etc. Complete. 184 Providing And Fixing In Position Tmt Fe 500, 25Mm Dia Dowel Bars Precoated With Anticorrosive Epoxy Paint Of Required Dia. 60 Cms. Long And At 30.00 Cm. C / C And Wherever Directedincluding Handling, Straightening, Necessarycuttingsupportedbytmtfe500, Chairswithproperalignmentbyusingproperlydesigned Assembly Of Bulkheads Lubricating Half Length With Bituminous Paint As Directed Etc. Complete. 185 Providing And Fixing In Position Tmt Fe 500, Tie Bars Precoated With Anticorrosive Epoxy Paint Of 12 Mm Dia.70Cms.Long Andat30.00Cm.C / C Andwhereverdirectedincludinghandling, Straighteningwrapping Withpaperofapprovedqualityforhalflength, Necessarycutting, Handling, Straightening, Supportedby Assembly Of Tmt Fe 500, Chairs With Proper Alignment Etc. Complete. 186 Cutting Transverse Contraction Joints 3 To 4 Mm Wide And Depth 60Mm. .In Concrete Slab Using Concrete Cutting Machinewithdiamondstuddedsawwithin48hoursofcastingofbay / Slabetc.Completeincluding Subsequent Widening Of The Groove 8 To 10 Mm. Wide At Top Having Depth Of 15 Mm. As Directed By Engineerincharge 187 Providingtocontractionjointspolysuphidesealent ( Pouringgrade ) Confirmingtobs:5212-1989Into Sawedgroovewidenedattopforsealentreservoirofspecifiedsizeandshapeasperdetaileddrawing Including Fixing Polyethylene Foam Backer Rod Of Required Diameter ( Appraox. 25%Larger Thanthe Initial 3 Mm.To 4 Mm. Joint ) Overlaid With Bond Breaking Tape As Per Detailed Drawing. Item Includes Cleaning The Joints Withwaterjet / Aircompressorandallowing Jointtobecomethoroughlydrybefore Sealentisappliedand Applying Primer. ( A ) Ct Ti D Litdilit ( 5 D Id ) 188 Providingandlaying125micronlowdensitypolyethylene ( Ldpe ) Sheetconfirmingtois3395:1997Below Concrete Pavement Including All Materials And Labour Complete 189 Providing And Fixing Factory Made Hydraulically Pressed Mechanically Vibrated And Compacted Precast Inter Lockingcementconcretepavingblocks80mmthickinm-40Gradeofapprovedsizeandshapeforcity Streets, Small / Medium Market Roads, Low Volume Roads, Utility Cuts On Arterial Roads Etc. As Specified And As Per Is15658:2006Including Costof Allmaterials, Manufacturing, Curing, Transportationof Blocksto Worksite Including Loading, Unloading And Stacking As Directed, Laying Paving Blocks In Position Over Prepared Bed Of Naturalsand / Crushedsandof50mmthicknessincludingnecessaryexcavationinallstratas, Spreading Blindge Of Fine Sand Over The Prepared Bed, Compacting Blocks By Plate Vibratoretc. Complete. 190 Providing And Fixing Factory Made Hydraulically Pressed Mechanically Vibrated And Compacted Precast Inter Lockingcementconcretepavingblocks100mmthickinm-50Gradeofapprovedsizeandshapeforcity Streets And Roads With High Volume / Heavy Traffice As Specified And As Per Is 15658:2006 Including Cost Of All Materials, Manufacturing, Curing, Transportationofblockstoworksiteincludingloading, Unloadingand Stacking As Directed, Laying Paving Blocks In Position Over Prepared Bed Of Natural Sand / Crushed Sand Of 50 Mm Thickness Including Necessary Excavation In All Stratas, Spreading Blindge Of Fine Sand Over The Prepared Bed, Compacting Blocks By Plate Vibratoretc. Complete. 191 Providing And Laying In Situ Cement Concrete M -30 With Tremix Treatment For 200 Mm Thickness For Concrete Road Is Including Laying Plastic Sheet For 125 Micron Thickness With Groove Cutting Of 4 Mm Wide And 20 Mm Deep With Necessary Refilling With Bitumen ( Excluding Reinforcement ) With Coarse And Fine Aggregate ( Natural Sand / Vsi Grade Finely Washed Crushed Sand ) Etc. Complete 192 Providing And Laying In Situ Cement Concrete M -30 With Tremix Treatment For 200 Mm Thickness For Concrete Road Is Including Laying Plastic Sheet For 125 Micron Thickness With Groove Cutting Of 4 Mm Wide And 20 Mm Deep With Necessary Refilling With Polysuphide Sealent ( Pouring Grade ) Confirming To Bs : 5212 - 1989 Into Sawedgroovewidenedattopforsealentreservoirofspecifiedsizeandshapeasperdetaileddrawing Including Fixing Polyethylene Foam Backer Rod Of Required Diameter ( Excluding Reinforcement ) With Coarsen And Fine Aggregate Using V.S.I.Quality Artifitial Sand Etc. Complete 193 Providing And Fixing Metre Stones As Per I.R.C. Standard Including Fixing In Standard Size Block Including Curingpainting Lettering Etc. Complete. Rcc 200 Meter Stone In Cc 1:4:8 194 Providing And Fixing Metre Stones As Per I.R.C. Standard Including Fixing In Standard Size Block Including Curingpainting Lettering Etc. Complete. Fixing 1:2:4 Ordinary Km. Stones In C.C. 1:4:8 195 Providing And Fixing Metre Stones As Per I.R.C. Standard Including Fixing In Standard Size Block Including Curingpainting Lettering Etc. Complete. Fixingr.C.C. 5Th Km. Stonesinc.C. 1:4:8 196 Dismantling Of Stone Including Cutting Of Earth, Foundation And Disposal Of Dismantled Materialwith All Lifts And Lead Upto 1000 M And Back Filling Of Pit. Dismantling 5Th Km. Stone 197 Dismantling Of Stone Including Cutting Of Earth, Foundation And Disposal Of Dismantled Materialwith All Lifts And Lead Upto 1000 M And Back Filling Of Pit. Ordinary Km. Stone 198 Dismantling Of Stone Including Cutting Of Earth, Foundation And Disposal Of Dismantled Materialwith All Lifts And Lead Upto 1000 M And Back Filling Of Pit. Hectometer Stone 199 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete 200 Mt. Stone 200 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete Ordinary Kilometer Stone 201 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete Lettering Of Fifth Km. Stone 202 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete Lettering Of Boundary Stone 203 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete Lettering For Cautionary / Mandatory Sign Boards And Village Name Boards 204 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete Lettering For Informatory Sign Boards Etc. Complete. 205 Painting With Approved Enamel Paint In Two Coats Including Cleaning Surface And Lettering For Stoneetccomplete Lettering On Masonry Works With Nalla Flow Direction, Span Number And Location Etc. Complete. 206 Painting Letters Upto 20 Cm Height Complete Brushes, Coir Brushers, Dusting, Cleaning, Including Cost Of Paintetc. Complete. 207 Painting And Numbering Trees With White Background And Black Lettering Etc. Complete. 208 Providing White Andcolour Washing To Roadside Trees In2coats In2bandsof White Andone Redbandat Centre Of 30 Cm Height Each Including Preparing The Surface, Cost Of Material, Conveying Etc. Complete. 209 Painting Line, Dashes, Arrows Etc On Roads In Two Coats On New Work With Ready Mixed Road Marking Paint Confirming To I.S. 164 On Bituminous Surface Including Cleaning The Surface Of All Dirt, Dust And Other Foreign Matter, Demarcation At Site And Traffic Control ( Over / Upto Cm Wide ) ( Morth-803 ) -- Surface Over 10Cm Wide On New Surface 210 Painting Line, Dashes, Arrows Etc On Roads In Two Coats On New Work With Ready Mixed Road Marking Paint Confirming To I.S. 164 On Bituminous Surface Including Cleaning The Surface Of All Dirt, Dust And Other Foreign Matter, Demarcation At Site And Traffic Control ( Over / Upto Cm Wide ) ( Morth-803 ) -- Surface Upto 10 Cm Wide On Old Surface 211 Painting Line, Dashes, Arrows Etc On Roads In Two Coats On New Work With Ready Mixed Road Marking Paint Confirming To I.S. 164 On Bituminous Surface Including Cleaning The Surface Of All Dirt, Dust And Other Foreign Matter, Demarcation At Site And Traffic Control ( Over / Upto Cm Wide ) ( Morth-803 ) -- Surface Over 10Cm Wide On Old Surface 212 Painting Line, Dashes, Arrows Etc On Roads In Two Coats On New Work With Ready Mixed Road Marking Paint Confirming To I.S. 164 On Bituminous Surface Including Cleaning The Surface Of All Dirt, Dust And Other Foreign Matter, Demarcation At Site And Traffic Control ( Over / Upto Cm Wide ) ( Morth-803 ) -- Surface Upto 10 Cm Wide On Old Surface 213 Supplying Andfixing Of Moldedshank Raisedpavement Markers / CatS Eyemade Of Polycarbonate And Absmouldedbodyandreflectivepanelswithmicroprismaticlenscapableofprovidingtotalinternal Reflectionofthelightenteringthelensfaceandshallsupportaloadof16000kgtestedinaccordanceto Astm D 4280 Typeh And Complyingtospecifications Of Category A Of Morth Circular No Rw / Nh / 33023 / 10-97Do Iii Dt 11.06. 1997. The Height, Width And Length Shall Not Exceed 50 Mm, 100 Mm And 102 + / - 2 Mm And With Minimum Reflective Area Of 13 Sqcm On Each Side And The Slope To The Base Shall Be 35 + / - 5 Degree. The Strength Of Detachment Of The Integrated Cylindrical Shanks, ( Of Diameter Not Less Than 19 + / - 2 Mm And Height Not Less Than 30+ / - 2 Mm ) From The Body Is To Be A Minimum Value Of 500 Kg. Fixing Will Be By Drilling Holes On The Road For The Shanks To Go Inside, Without Nails And Using Epoxy Resin Based Adhesive As Per ManufacturerS Recommendation And Complete As Directed By The Engineer.The Contractor Shall Submitatwoyearwarranty Forsatisfactoryfieldperformanceincludingstipulatedretro-Reflectanceofthe Reflecting Panel, To The Engineer. 214 Providingandfixingofmedianmarkerthataremadeoftough, Highimpactresistant, Injection-Molded, Thermoplasticbodywithanisoscelestrapezoidalstructure Oflength, Widthandheightnotlessthan15cm, 10Cm And10cm Respectively Andthickness Not Less Than1.8Mm, The Body Structure Shall Be Roundedatits Acute Angle, All The Corners And Edges. The Plastic Used For Molding The Median Marker Shall Have A Minimum Notched Izod Impact Strength Value Of 600 J / M At Room Temperature, When Tested In Accordance With Astm D256 And Shall Retain At Least 70% Of This Value When Subjected To Accelerated Weathering For 1000Hrs As Per Astm G155 Or Ul746c. The Logo Of The Manufacturer Shall Be Embossed On Either Side Of The Body In The Injection Molding Process. The Median Marker Shall Have Rectangular-Shaped, Fluorescent Yellow Color Retro- Reflective Sheeting Of Size Not Less Than 8.5Cm*8.5Cm And With Fully Reflective Micro Prismatic Cube Corners As Its Retro-Reflective Elements As Per Irc 67 2010 Andastm D4956 Type Xi Specifications Reflectivity Values. The Retro-Reflective Sheeting Shall Be One Or Both Sides Of The Median Marker And Shall Be Edge Protected With No Exposed Edges Which Will Prevent Edge Lifting, Vandalism, Sheeting Damage, Etc. The Median Marker Shall 215 Providingandfixingreflectivefluorescenttapeonoldroadsignboardbyfollowingtheprocedure Recommandedbymanufacturer.Tapeshallbeconsistofwhiteorcolouredsheetinghavingsmoothouter Surface Which Has The Property Of Retro-Reflection Over Its Entire Surface.It Shall Be Weather Resistant And Show Colour Fastness.It Shall Be New And Unused And Shall Show No Evidance Of Cracking, Scaling, Pitting, Blisting, Edge Lifting And Shall Have Negligible Shrinkage Or Expansion Including Cleaning / Scraping And Painting Of Existing Board Etc. Complete. ( Guidance On The Recommanded Application Of Each Class Of Tape May Be Taken From Irc-67 ) 216 Road Marking With Hot Applied Thermoplastic Compound With Reflectorizing Glass Beads On Bituminous Surface- Providing And Laying Of Hot Applied Thermoplastic Compound 2.5 Mm Thick Including Reflectorizing Glass Beads @ 250 Gms Per Sqm Area, Thickness Of 2.5 Mm Is Exclusive Of Surface Applied Glass Beads As Per Irc:35 .The Finished Surface To Be Level, Uniform And Free From Streaks And Holes.Complete. 217 Providing And Applying Cold Plastic Paint Two Component Rolled On Surfacing Material Solvent Free, High Build Two Pack Seamless, Tough, Skid Resistant, Material With Has Property Of Attaining 2.00Mm Thickness In Single Coat Application White ( Or As Required Colour ) Based On Glass And Colour Retaining Acralic Cross Linking Resin System For Coloured Road Surfacing Including Surface Cleaning And Cost Of All Material Etc. Complete. ( All Inclusive On Bitumen Or Concrete Surface ) Work Shall Carried Out As Per Irc 35-2015 Clause 2.2 ) 218 Providing And Fixing Aluminum-Backed Flexible Prismatic ( Afp ) Sheeting Consisting Yellow Colored Flexible Prismatic Sheeting With Non-Metallic Prismatic Lens As Retroreflective Elements And Conforming To Astm D 4956-09 Type Vi Specification For Rebound Able Retroreflective Sheeting. This Flexible Prismatic Sheeting Shall Beof1ftwidthandlaminatedatthebackwitha50micronaluminum ( Al ) Foilwithpressuresensitive Adhesive And Liner. Further, This Flexible Prismatic Sheeting Shall Have Screen Printed Arrow / Slant Line Pattern In Black Color Ina Continuous Roll Format. Neither Afpsheeting Nor The Flexible Prismatic Sheeting Used Init Shall Crack When Slowly Bent In 1 Second Time Around A 1 / 8Th Inch Mandrel After Being Conditioned For 24Hrs At 0?C And Tested As Per Section S2.2.2. Of Astm D 4956-09. The Afp Sheeting, With The Liner Removed, Shall Be Appliedwitha Neoprene Contact Adhesive Witha Polychloroprene As Base, Viscosity Of 200-450 Cps And Solid Content Of 20-30%. Once Applied, The Edges Of The Product Shall Be Sealedall Aroundwith A Two-Part Epoxy Based Structural Adhesive And Shall Be Extremely Resistant To Peel-Off. A Test Report From Institutes Like 219 Providing Vertical Delineator Having Wide Angle Cube Corner Micro Prismatic Non Metallic Reflective Sheeting Confirmingtotypexiofastmd4956-09 Withwhitecolorandredcolorcombinationandhaving Minimum Of Retro Reflective Exposed Area Of 125 Sq Cm On Top Slots And 35 Sq Cm On Bottom Slots And No Edges Shall Be Exposed For Tampering. This Tubular Delineator Shall Have A Core And Shell Construction, Shell Shall Be Made Of Tough, High Impact Resistant, Injection-Molded, Thermoplastic Outer Body And The Inner Core Shallconsistof Powdercoatedorpaintedmildsteel Ofminimum Thickness1.0Mm.Andcore-Shellstructure Shall Be Of Height Not Less Than 800 Mm Above The Ground And Width Not Less Than 80 Mm. The Metallic Core Of Thedelineatorshallextend300mmbeyondtheshelllengthfrombottomforinstallingintheground.The Extendedportionshallhave Slotsto Insertanchoring Rodsfor Enhancing The Concrete Grip. The Logo Ofthe Manufacturer Shall Be Embossed On Either Side Of The Body In The Injection Molding Process. The Engineering Thermoplasticusedformakingthedelineatorbodyshallhaveminimuminitialmechanicalpropertiesof60j / D Idi H Atm D26h I L 7% Ofh Ii Ii Il 220 Roaddelineators: Supplyingandinstallationofdelineators ( Roadwayindicators, Hazardmarkers, Object Markers ) 80To 100Cm Highabove Groundlevel, Paintedblack Andwhite In15cm Wide Strips, Fittedwith 80X100mm Rectangular Or 75Mm Dia. Circular Reflectorised Panels At The Top, Buried Or Pressed Into The Groundand Confirming To I R C79 And The Drawings 221 Providing And Fixing Steel Pipe Delineators Of 10 Cm. In Diameter And Total Height Of 130 Cm, Provided With 2 Strips Of White Retroreflective Sheeting Of Size 5Cm.X32.5Cm. Eachfixedhorizontallyand2strips Ofred Retroreflectivesheetingeachhavingsize5cm.X32.5Cm.Fixedhorizontallyattop, Withm.S.Roundcap Having Diameter 11 Cm. And Wire Mesh At Top ( 10 Guage Thick ) And Height Of Wire Mesh 15 Cm, M.S. Hold Fast 6 Mm Thick With 35 Cm. In Length, Fixing The Delineators In C.C. 1:4:8 Concrete Block Of Size 25 Cm. X 25 Cm. X 45 Cm. With Necessary Excavation Etc. Complete. 222 Supplying Of Solar Raised Pavement Markers Made Of Polycarbonate Molded Body With Circular Shape, Solar Powered, Ledselfilluminationinactivemode, 360Degreeilluminationandreflectivepanelswithmicro Prismatic Lens Capable Of Providing Total Internal Reflection Of The Light Entering The Lens Face In Passive Mode. The Marker Shall Support A Load Of 20000 Kg Tested In Accordance To Astm D 4280. The Marker Should Be Resistanttodustandwateringressaccordingtoip65standardsandshouldwithstandtemperaturesinthe Range Of 0 C To 70 C.Color Of Lighting Could Be Provided In Red Or Yellow ( Amber ) As Per Requirement And Typical Frequency Of Blinking Is 1 Hz. There Should Be Current Losses Of Less Than 20 Micro-Amperes At 2.4 V In Sleep-Chargingmodetoenhancethelifeofthemarkerandafullchargeshouldprovideforaminimum Autonomy Of 50 Hours. The Height, Width And Length Of The Marker Shall Not Be Less Than 10 Mm X 100 Mm X 100 Mm. Also, The Surface Diameter Of The Marker Shall Not Be Less Than 100 Mm Respectively. The Weight Of The Marker Shall Not Exceed 0.5 Kilograms.Fixing Will Be By Drilling Holes On The Road For The Shanks To Go 223 Supplying Precast Conventional Reflective Delinators On Four Sides For Road Signs 224 Fixing Inpositioncautionary / Mandatory Signboards Ingroundwithcc1:4:8Blockof 60Cm X60cm X75cm Size Etc. Complete As Directed Including All Leads. 225 Fixing In Position Road Junction / Informatory Sign Board In Ground With C.C.1:4:8 Block Of 60Cm X 60Cm X75cm Size Including All Leads Complete. 226 Providingandfixingincludingconveyancechargesuptoadistanceof200km.Precastconcretepost Delinators, Post Of Size 130 X 90 X 1300 Milimetre Consisting Of 4 B.T. Wires With 14, 000 Kg / Cm2 C.C. M-20 Grade 16Mm Dia. Holdfast, Including Excavationandc.C. 1:4:8Foundationblock, Oil Painting Post With3 Coats And Red Fluorescent Tape 75 X 75Mm And White Floursent Border 20Mm Wide Around The Red Tape On All The Four Sides With Necessary Adhesive And Lamination Etc. Complete. 227 Supplying Rolled Steel Channel Post Of 100 X 50 Mm ( Ismc ) Drilled On Top And Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint Having Black And White Bands Of 25 Cm Last Part Of The Post 0.75 M Below Ground Level Is Painted With Three Coats Of Red Lead Paint With 2 Nos. Of High Tensile G.I. Bolt And Nut Of Size10mmdia.Of25mmlongincludingtransportationetc.Complete.Spec.No.:Asperirc-67, Andm.O.R.T. And H. Circular No. Rw / Nh-33023 / 31 / 88 D.O.Iiidated 2-5-1994 228 Supplying M.S. Angle Iron Post Of Size 65 Mm X 65 Mm X 6 Mm Drilled On Top And Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint Having Black And White Bands Of 25 Cm, Last Part Of The Post0.75 M Below Ground Level Is Painted With Three Coats Of Red Lead Paint With 2 Nos. Of High Tensile G.I. Bolt And Nut Of Size 10 Mm Dia. Of 25 Mm Long Including Transportation Etc. Complete. Spec. No. : As Per Irc-67, Andm.O.R.T. And H. Circular No. Rw / Nh-33023 / 31 / 88 D.O.Iii Dated 2-5-1994 229 Supplying M.S. Angle Iron Post Of Size Duly Painted With One Coat Of Red Oxide Paint And Two Coats Of Synthetic Enamel Finish Paint Having Black And White Bands Of 25 Cm Width Including 2 Nos Of G.I. Bolt And Nut Of Size 10 Mm Dia. And 20 Mm Long Including Transportation Etc. Complete. Spec. No. : As Per Irc-67, And M.O.R.T. And H. Circular No. Rw / Nh-33023 / 31 / 88 D.O.Iiidated 2-5-1994 Post Of Size 65 Mm X 65 Mm X 6 Mm 230 Supplying M.S. Angle Iron Post Of Size Duly Painted With One Coat Of Red Oxide Paint And Two Coats Of Synthetic Enamel Finish Paint Having Black And White Bands Of 25 Cm Width Including 2 Nos Of G.I. Bolt And Nut Of Size 10 Mm Dia. And 20 Mm Long Including Transportation Etc. Complete. Spec. No. : As Per Irc-67, And M.O.R.T. And H. Circular No. Rw / Nh-33023 / 31 / 88 D.O.Iiidated 2-5-1994 Post Of Size 50 Mm X 50 Mm X 5 Mm 231 Supplying M.S. Angle Iron Frame For Informatory Sign Boards Of Size 35 Mm X 35 Mm X 3 Mm Welded And Making Neccesary Holes Required For Fixing And Painted With One Coat Of Epoxy Primer And Two Coats Epoxy Finishpaintetc.Complete.Spec.No.:Asperirc-67, Andm.O.R.T.Andh.Circularno.Rw / Nh-33023 / 31 / 88 D.O.Iii Dated 2-5-1994 232 Providing And Constructing Informationpillar Of Brick Masonry In C.M. 1:6 Of Size 2.0 M X 0.23M X 1.0 M With Base Pedestal Of Size 2.3 M X 0.35 M X 0.45 M ( 0.3 M Above Ground ) , Excavtion In Ground Upto 0.4 M, Laying 0.15 M Thick 80 Mm Soling, 0.10 M Thick C.C. 1:3:6, Finishing The Pedestal And Pillar In Cement Plaster 12 Mm Thickinc.M.1:5Andfinishing The Pillarwithneatcementfinish, Applying Flatoilpaintofapproved Colourintwocoats, Includingcuring, Finishingetccomplete. ( Instrata / Soil ) Spec.No.:Asdirected By Engineer-In-Charge In Strata Other Than B.C. Soil 233 Providing And Constructing Informationpillar Of Brick Masonry In C.M. 1:6 Of Size 2.0 M X 0.23M X 1.0 M With Base Pedestal Of Size 2.3 M X 0.35 M X 0.45 M ( 0.3 M Above Ground ) , Excavtion In Ground Upto 0.4 M, Laying 0.15 M Thick 80 Mm Soling, 0.10 M Thick C.C. 1:3:6, Finishing The Pedestal And Pillar In Cement Plaster 12 Mm Thickinc.M.1:5Andfinishing The Pillarwithneatcementfinish, Applying Flatoilpaintofapproved Colourintwocoats, Includingcuring, Finishingetccomplete. ( Instrata / Soil ) Spec.No.:Asdirected By Engineer-In-Charge In B.C. Soil With 12 Mm Thick R.C.C. Raft In M-15Including Reinforcement E. 234 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 600 Mm Diamade Out Of 1.5Mm Aluminum Sheet 235 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 600 Mm Diamade Out Of 3Mm Aluminum Composite Material 236 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 750 Mm Diamade Out Of 2Mm Aluminum Sheet 237 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 750 Mm Diamade Out Of 4Mm Aluminum Composite Material 238 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 900 Mm Diamade Out Of 2Mm Aluminum Sheet 239 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 900 Mm Diamade Out Of 4Mm Aluminum Composite Material 240 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 1200 Mm Diamade Out Of 2Mm Aluminum Sheet 241 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 1200 Mm Diamade Out Of 4Mm Aluminum Composite Material 242 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.600 Mm Diamade Out Of 1.5Mm Aluminum Sheet 243 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.600 Mm Diamade Out Of3mm Aluminumcomposite Material 244 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.750 Mm Diamade Out Of 2Mm Aluminum Sheet 245 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.750 Mm Diamade Out Of4mm Aluminum Composite Material 246 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.900 Mm Diamade Out Of 2Mm Aluminum Sheet 247 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.900 Mm Diamade Out Of4mm Aluminum Composite Material 248 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1200 Mm Diamade Out Of 2Mm Aluminum Sheet 249 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1200 Mm Diamade Out Of4mm Aluminum Composite Material 250 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 600 Mmmade Out Of 1.5Mm Aluminum Sheet 251 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 600 Mmmade Out Of 3Mm Aluminum Composite Material 252 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 750 Mmmade Out Of 2Mm Aluminum Sheet 253 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe750 Mmmade Out Of 4Mm Aluminum Composite Material 254 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 900 Mm Out Of 2Mm Aluminum Sheet 255 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 900 Mmmade Out Of 4Mm Aluminum Composite Material 256 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 1200 Mmmade Out Of 2Mm Aluminum Sheet 257 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe 1200 Mmmade Out Of 4Mm Aluminum Composite Material 258 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 600 Mmmade Out Of 1.5Mm Aluminum Sheet 259 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 600 Mmmade Out Of3mm Aluminum Composite Material 260 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 750 Mmmade Out Of 2Mm Aluminum Sheet 261 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 750 Mmmade Out Of4mm Aluminum Composite Material 262 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 900 Mmmade Out Of 2Mm Aluminum Sheet 263 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 900 Mmmade Out Of4mm Aluminum Composite Material 264 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1200 Mmmade Out Of 2Mm Aluminum Sheet 265 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1200 Mmmade Out Of4mm Aluminum Composite Material 266 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensitymicro- Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint Andsupported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M25 Grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have 7 Years Written Warrantyfrom The Manufacturer And Authorised Distributor / Convertor Issued For Field Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Film And This Warranty Certificatein Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 750 Mmmade Out Of 2Mm Aluminum Sheet 267 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensitymicro- Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint Andsupported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M25 Grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have 7 Years Written Warrantyfrom The Manufacturer And Authorised Distributor / Convertor Issued For Field Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Film And This Warranty Certificatein Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 750 Mmmade Out Of 4Mm Aluminum Composite Material 268 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensitymicro- Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint Andsupported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M25 Grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have 7 Years Written Warrantyfrom The Manufacturer And Authorised Distributor / Convertor Issued For Field Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Film And This Warranty Certificatein Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 900 Mm Out Of 2Mm Aluminum Sheet 269 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensitymicro- Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint Andsupported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M25 Grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have 7 Years Written Warrantyfrom The Manufacturer And Authorised Distributor / Convertor Issued For Field Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Film And This Warranty Certificatein Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 900 Mmmade Out Of 4Mm Aluminum Composite Material 270 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classc ( Typeximicroprismaticgrade Sheeting ) Having Pressure Sensitive / Heat Activatedadhesive Retoreflective Specifiedbackground, Borderand Backside Retoreflctive Symbols, Letters, Numerals, Arrowasper Irc:67-2012Table No8.3Supportedwith Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 750 Mmmade Out Of 2Mm Aluminum Sheet 271 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classc ( Typeximicroprismaticgrade Sheeting ) Having Pressure Sensitive / Heat Activatedadhesive Retoreflective Specifiedbackground, Borderand Backside Retoreflctive Symbols, Letters, Numerals, Arrowasper Irc:67-2012Table No8.3Supportedwith Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 750 Mmmade Out Of4mm Aluminum Composite Material 272 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classc ( Typeximicroprismaticgrade Sheeting ) Having Pressure Sensitive / Heat Activatedadhesive Retoreflective Specifiedbackground, Borderand Backside Retoreflctive Symbols, Letters, Numerals, Arrowasper Irc:67-2012Table No8.3Supportedwith Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 900 Mmmade Out Of 2Mm Aluminum Sheet 273 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classc ( Typeximicroprismaticgrade Sheeting ) Having Pressure Sensitive / Heat Activatedadhesive Retoreflective Specifiedbackground, Borderand Backside Retoreflctive Symbols, Letters, Numerals, Arrowasper Irc:67-2012Table No8.3Supportedwith Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 900 Mmmade Out Of4mm Aluminum Composite Material 274 Providing Andfixing Of Retro- Reflectorisedinformatory Signboardrectangular / Square Inshape Having Area Less Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On One No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting 2Mm Aluminum Sheet Class B 275 Providing Andfixing Of Retro- Reflectorisedinformatory Signboardrectangular / Square Inshape Having Area Less Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On One No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting 4Mm Aluminum Composite Materialclass B 276 Providing Andfixing Of Retro- Reflectorisedinformatory Signboardrectangular / Square Inshape Having Area Less Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On One No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting 2Mm Aluminum Sheet Ofclass C 277 Providing Andfixing Of Retro- Reflectorisedinformatory Signboardrectangular / Square Inshape Having Area Less Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On One No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting 4Mm Aluminum Composite Material Class C 278 Providing And Fixing Of Retro- Reflectorisedinformatory Sign Board Rectangular / Square In Shape Having Area Greater Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On Two No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting 2Mm Aluminum Sheet Class B 279 Providing And Fixing Of Retro- Reflectorisedinformatory Sign Board Rectangular / Square In Shape Having Area Greater Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On Two No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting4mm Aluminum Composite Materialofclass B 280 Providing And Fixing Of Retro- Reflectorisedinformatory Sign Board Rectangular / Square In Shape Having Area Greater Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On Two No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting2mm Aluminum Sheet Bondedofclass C 281 Providing And Fixing Of Retro- Reflectorisedinformatory Sign Board Rectangular / Square In Shape Having Area Greater Than 0.9 Square Meter Made Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Of Class ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Havingpressuresensitive / Heat Activatedadhesiveretoreflective Specifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrowas Per Irc:67-2012Table No 8.3, Supported Withback Supportframe 25Mm X25mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On Two No. Mild Steel Angleironpost75mmx75mmx6mm, 3.5Mtlongfirmlyfixedtothegroundbymeansofproperly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Ofepoxyfinishpaintshavingalternateblackandwhitebandsof25cmwidthincludinggifixuresand Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting4mm Aluminum Composite Materialofclass C 282 Providinganderectingoverheadsignsmadeoutof Mmaluminumsheetbondedwithwhiteretro Reflective Sheeting Of Class ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heatactivatedadhesiveretoreflectivespecifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012, With Designed Back Support Frame Of Mild Steel Angle With Vertical And Lateral Clearance Given In Clause 801 And 802, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Installed As Per Clause 802.6 Over A Designed Support System Of Structural Steel Worktrestlesandtrussesofsectionsandtypeasperstructuraldesignrequirementsandapprovedplans Including Painting With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv Highintensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting Shall Have 7Yearswrittenwarrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprintedd H D Bll Fildhi I 2Mm Aluminum Sheetof Class B 283 Providinganderectingoverheadsignsmadeoutof Mmaluminumsheetbondedwithwhiteretro Reflective Sheeting Of Class ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heatactivatedadhesiveretoreflectivespecifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012, With Designed Back Support Frame Of Mild Steel Angle With Vertical And Lateral Clearance Given In Clause 801 And 802, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Installed As Per Clause 802.6 Over A Designed Support System Of Structural Steel Worktrestlesandtrussesofsectionsandtypeasperstructuraldesignrequirementsandapprovedplans Including Painting With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv Highintensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting Shall Have 7Yearswrittenwarrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprintedd H D Bll Fildhi I 4Mm Aluminum Composite Materialof Class B 284 Providinganderectingoverheadsignsmadeoutof Mmaluminumsheetbondedwithwhiteretro Reflective Sheeting Of Class ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heatactivatedadhesiveretoreflectivespecifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012, With Designed Back Support Frame Of Mild Steel Angle With Vertical And Lateral Clearance Given In Clause 801 And 802, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Installed As Per Clause 802.6 Over A Designed Support System Of Structural Steel Worktrestlesandtrussesofsectionsandtypeasperstructuraldesignrequirementsandapprovedplans Including Painting With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv Highintensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting Shall Have 7Yearswrittenwarrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprintedd H D Bll Fildhi I 2Mm Aluminum Sheetofclass C 285 Providinganderectingoverheadsignsmadeoutof Mmaluminumsheetbondedwithwhiteretro Reflective Sheeting Of Class ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heatactivatedadhesiveretoreflectivespecifiedbackground, Borderandbacksideretoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012, With Designed Back Support Frame Of Mild Steel Angle With Vertical And Lateral Clearance Given In Clause 801 And 802, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Installed As Per Clause 802.6 Over A Designed Support System Of Structural Steel Worktrestlesandtrussesofsectionsandtypeasperstructuraldesignrequirementsandapprovedplans Including Painting With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class B ( Type Iv Highintensity Micro-Prismatic Grade Sheeting-Hip ) Sheeting Shall Have 7Yearswrittenwarrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprintedd H D Bll Fildhi I 4Mm Aluminum Composite Material Class C 286 Providing And Fixing Board Displaying Information, Such As Name Of Work, Tender Cost, Name Of Contractor, Work Completion And Liability Period Etc, Having Rectangular Shape Of 1.20M X 0.90M Size Made Out 18 Gauge ( 1.25Mm ) Thickmildsteelsheetpaintedwithonecoatofzincchromatestovingprimerandtwocoatsof Enamelpaintonfrontside Andgreystove Enamelonbackside Andborder / Messages / Symbolsetc.With Approved Colour Shade Paint Complete, On M.S.Angle Of Size 35 X 35 X 3 Mm Frame With Properly Cross Bracedm.S. Angles Of Size 35Mmx35mmx3mm Duly Painted Including Two M.S. Angle Iron Posts Of Size 65 Mm X 65 Mm X 6 Mm, 3.65 M Long Painted With Alternate Black And White Bands Of 25 Cm Width Including All Fixtures Etc.Andfixingtheboardsin1:4:8Concreteblockofsize60cmx60cmx75cmincluding, Excavation, Refilling, Transportation, And Labour Etc Complete. Spec. No. As Directed By Engineer In Charge 287 Providingandfixingr.C.C.Precastcement Concretem-15Pedestalofsize0.75X0.75X0.20M Includingcostofsteelreinforcementforkm.Stoneasperdetaileddrawingandspecificationincludingtransportation Of Pedestal Blockall Lifts Etccomplete 288 Providing And Fixing Cautionary / Warning Sign Board Of Size 60 Cm. Having Shape Of Equilateral Triangle With Apexpointupwards.Preparedon16gaugem.S.Sheetincludingpaintingwithonecoatofzinccromate Stovingprimerandtwocoatseachofwhitebackground, Redborderandbacksidegraystoveenamelled, Bonded With Cut Out Of Retro Reflective Sheet Engineering Grade, Symbol / Letters / Numerals / Border / Arrow, Coatedwithnonpealablecrystalclearprotectivetransparentcoatretaining100%Reflectionincludingone Number Of M.S. Angle Iron Post Of Size 50 X 50 X 5 Mm Of 3.65 M. Long Inflated At Bottom Drilled On Top In One Piece Without Joint Painted With White And Black Bands Of 30 Cm. Fixing Board And Post With 2 Nos. High Strengthg.I.Boltsandnutsofsize10mm Dia.And20mm Longincludingalltaxes, Conveying, Fixingin Groundwithcement Concrete 1:4:8Block Of60cm X60cm X75cm Size Etc.Complete.60Cm.Equilateral Triangle M.S. Sheet With Engineering Grade, 289 Providing And Fixing Mandatory / Regulatory Sign Board Of Circular Shape Of Size 60 Cm. Dia. Prepared On 16 Gaugem.S.Sheetincludingpaintingwithzincchromatestoving Primerandtwocoatseachofwhiteback Ground, Redborderandbacksidegraystoveenamelled, Bondedwithcutoutofretroreflectivesheet Engineeringgrade, Symbol / Letters / Numerals / Border, Coatedwithnonpealablecrystalclearprotective Transparent Coat Retaining 100% Relection Including One Number Of M.S. Angle Iron Post Of Size 50 X 50 X 5 Mm Of 3.45 M. Long Inflated At Bottom Drilled On Top In One Piece Without Joint Painted With White And Black Bands Of 30 Cm. Fixing Board And Post With 2 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Including All Taxes, Conveying, Fixing In Ground With Cement Concrete 1:4:8 Block Of 60 Cm X 60 Cm X75cmsizeetc.Complete.Circularshapeofsize60cm.Dia.M.S.Sheetwithretroreflectivesheet Engineering Grade 290 Providing And Fixing Sign Boards Of Size 90Cm Having Shape Of An Equilateral Triangle Made Out Of 14 Gauge Sheet With Retro Reflective Sheeting Of Engineering Grade As Per M.O.T. Specification No. 801-3 ( 1993 ) White Reflective Background, Lettering Symbolbordering Ofblack Nonreflective Paintincluding M.S. Angle Iron Back Frame Of Size 35 Mm X 35 Mm X 5 Mm &M.S.Angle One Post Of 50Mm X 50Mm X 5Mm Size 3.45 Metre Long Duly Painted With White And Black Bands Including Fixingm.S. Angle Of The Boards With Galvanised Nuts Andbolts And Washers. The Boardshall Be As Per Irc-67-1977 Including Conveying Fixing In Groundwithc.C. 1:4:8 Block Of Size 0.60 X 0.60 X 0.75 M, With 7 Year Guarantee For The Sheeting Etc. Complete. Mild Steel Board With Engineering Grade 291 Providingandfixingroadjunction / Information Signboardsofsize1.80 X0.90Meterprepared16 Guagem.S.Sheetonframeofm.S.Angle Ofsize35x35x5mmwithcrossbracingofsize35x35x5mm Includingpaintingwithonecoatofzinccromatestovingprimerandtwocoatseachofgreen / Whiteback Ground And Back Side Gray Stove Enamelled, Bonded With Red Retro Reflective Sheet Engineering Grade, Border / Letters / Numeral / Arrows, Coatedwithnonpealable Crystal Clearprotective Transperentcoat Retaining 100% Reflection Including Two Angle Iron Post Of Size 65 X 65 X 6 Mm Of 3.65 M. Long Inflated At Bottom , Drilled On Top And Painted In White And Black Bands Of 30 Cm. With 4 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long. Sheet And Angle Iron Post In One Piece Without Joints Including All Taxes, Conveying, Fixing In Ground With Cement Concrete 1:4:8 Block Of 60 Cm X 60 Cm X 75 Cm Size As Directed By Engineer-In- Charge Etc. Complete. Mild Steel Board With Engineering Grade. 292 Providingandfixingroadjunction / Informationsignboardsofsize1.80X0.90Meterprepared16guage Alluminium Sheet On Frame Ofsize 35 X 35 X 5 Mm With Cross Bracing Of Size 35X35x5 Mm Including Bonded Withircspecifiedcolourof Retroreflectivesheetingoftypeivhighintensitymicro-Prismaticgrade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutout Border&Messageshavingpressuresensitiveadhesivehavingborder&Messagesinircspecifiedcolour Background Including Two Angle Iron Post Of Size 65 X 65 X 6 Mm Of 3.65 M. Long Inflated At Bottom Drilled On Top And Painted In Whiteand Black Bands Of 30 Cm. With 4 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia.And20mm Long Sheetandangleironpostinonepiece Withoutjointsincludingalltaxes, Conveying, Fixing In Ground With Cement Concrete 1:4:8 Block Of 60 Cm X 60 Cm X 75 Cm Size As Directed By Engineer-In- Charge Etc. Complete.Alluminium Sheet Type Iv High Intensity Micro-Prismatic Grade Sheeting. 293 Providing And Fixing Informatory Sign Boards In Rectangular Shape Of Size 1.80M X 0.90M Made Out Of 3Mm Aluminum Composite Panel Bonded With Irc Specified Colour Ofretro Reflective Sheeting Of Type Iv High Intensitymicro-Prismaticgradesheeting ( Hip ) Havingpressuresensitive / Heatactivatedadhesive, Irc Specified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Background Including M. S. Angle Iron Frame Of Size 35 Mm X 35 Mm X 5 Mm & Two M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M-20 Concreteblockofsize60cmx60cmx75cmincludingtransportationetc;Complete. Aluminum Composite Panel With Type Iv High Intensity Micro-Prismatic Grade Sheeting. 294 Providingandfixingroadjunction / Informationsignboardsofsize1.80X1.20Meterprepared16guage M.S.Sheet On Frame Of Size 40X40x5 Mm With Cross Bracing Of Size 35X35 X 5 Mm Including Painting With One Coat Of Zinc Cromate Stoving Primer And Two Coats Each Of Green / White Back Ground And Back Side Gray Stove Enamelled, Bonded With Red Retro Reflective Sheet Engineering Grade, Border / Letters / Numeral / Arrows, Coated With Non Pealable Crystal Clear Protective Transperent Coat Retaining 100% Reflection Includingtwo Angle Iron Post Of Size 65 X 65 X 6 Mm Of 3.65 M. Long Inflated At Bottom Drilled On Top And Painted In Whiteand Black Bands Of 30 Cm. With 4 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Sheet And Angleironpostinonepiecewithoutjointsincludingalltaxes, Conveying, Fixingingroundwithcement Concrete 1:4:8 Block Of 60 Cm X 60 Cm X 75 Cm Size As Directed By Engineer-In- Charge Etc. Complete.Mild Steel Board With Engineering Grade. 295 Providingandfixingroadjunction / Informationsignboardsofsize1.80X1.20Meterprepared16guage Alluminium Sheet On Frame Of With Angle Iron Frame Of Size40x40x5mm With Cross Bracing Of Size 35X35x5 Mm Including Type Iv High Intensity Micro-Prismatic Grade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Back Groundincluding Two Angle Iron Post Of Size 65 X 65 X 6 Mm Of 3.65 M. Long Inflated At Bottom Drilled On Top And Painted In Whiteand Black Bands Of 30 Cm. With 4 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Sheet And Angle Iron Post In One Piece Without Joints Including All Taxes, Conveying, Fixing In Ground With Cement Concrete 1:4:8 Block Of 60Cm X60cm X75cm Size As Directedby Engineer-In-Charge Etc.Complete. Alluminium Sheet Type Iv High Intensity Micro-Prismatic Grade Sheeting. 296 Providing And Fixing Informatory Sign Boards In Square Or Rectangular Shape Of Size 1.80M X1.20M Made Out Of 3Mm Aluminum Composite Panel Bonded With Irc Specified Colour Ofretro Reflective Sheeting Of Type Iv High Intensity Micro-Prismatic Grade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Background Including M. S. Angle Iron Frame Of Size 35 Mm X 35 Mm X 5 Mm & Two M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M-20 Concreteblockofsize60cmx60cmx75cmincludingtransportationetc;Complete. Aluminum Composite Panel With Type Iv High Intensity Micro-Prismatic Grade Sheeting. 297 Providing And Fixing Road Junction / Information Sign Board Of Size 0.90 M X 0.60 M. Prepared On 16 Gaugem.S.Sheetwithangleironframeofsize35x35x5mmincludingpaintingwithonecoatofzinccromate Stoving Primer And Two Coats Each Of Green / White Back Ground And Back Side Gray Stove Enamelled, Bonded With Red Retro Reflective Sheet Engineering Grade, Border / Letters / Numeral / Arrows, Coated With Non Pealable Crystal Clear Protective Coat Retaining 100% Reflection Including Two Angle Iron Post Of Size 50X50x5 Mm Of3.65 M. Long Inflated At Bottom Drilled On Top And Painted In White And Black Bands Of 30 Cm. With 4 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Sheet And Angle Iron Post In One Piece Without Joints Including All Taxes, Conveying, Fixing In Ground With Cement Concrete 1:4:8 Block Of 60 Cm X 60 Cm X 75 Cm Size As Directed By Engineer-In-Charge Etc. Complete. Mild Steel Board With Engineering Grade. 298 Providing And Fixing Informatory Sign Boardsof Size 0.90 X 0.60 M Made Out Of 14 Guage Aluminum Sheet Bondedwithircspecifiedcolourof Retroreflectivesheetingoftypeivhighintensitymicro-Prismatic Grade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutoutborder&Messageshavingpressuresensitiveadhesivehavingborder&Messagesinircspecified Colour Background Including On Frame Of With Angle Iron Frame Of Size 35 X 35 X 5 Mm And Two M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In 1:4:8 Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete.Alluminium Sheet Type Iv High Intensity Micro-Prismatic Grade Sheeting 299 Providingandfixinginformatorysignboardsshapeofsize0.90X0.60Mmadeoutof3mmaluminum Composite Panelbondedwithircspecifiedcolourof Retroreflective Sheetingoftypeivhighintensity Micro-Prismaticgradesheeting ( Hip ) Havingpressuresensitive / Heatactivatedadhesive, Ircspecified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Background Including M. S. Angle Iron Frame Of Size 35 Mm X 35 Mm X 5 Mm &M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternateblackandwhitebandsof25cmwidthincludingg.I.Fixturesetc;Fixingtheboardsinm-20 Concrete Block Of Size 60Cm X60cm X75cm Including Transportation Etc; Complete. Aluminum Composite Panel With Type Iv High Intensity Micro-Prismatic Grade Sheeting.Spec.No. As Per Irc-67, 2015 300 Providingandfixingsignboardsofsize Size60x80cmmadeoutof14gaugem.S.Sheetwithretro Reflective Sheeting Of Engineering Grade As Per M.O.T. Specification No. 801-3 ( 1993 ) White Reflective Back Ground, Lettering Symbol Bordering Of Black Non Reflective Paint Including 3.65 Metre Long M.S.Angle One Post Of 65 X 65 X 6 Mm Size Duly Painted With White And Black Bands Including Fixing The Boards Of M.S. Angle Withgalvanisednutsandboltsandwasher.Theboardshallbeasperirc-67-1977Includingconveying Fixing In Ground With C.C. 1:4:8 Block Of Size 0.60 X 0.60 X 0.75 M, With 7 Year Guarantee For The Sheeting Etc. Complete.Mild Steel Board With Engineering Grade. 301 Providing And Fixing Informatory Sign Boardsof Size 60 Cm X 80 Cm Made Out Of 14 Guage Aluminum Sheet Bondedwithircspecifiedcolourof Retroreflectivesheetingoftypeivhighintensitymicro-Prismatic Grade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutoutborder&Messageshavingpressuresensitiveadhesivehavingborder&Messagesinircspecified Colour Backgroundincluding M.S. Angle Ironpost Of Size65mm X65 Mm X 6Mm, 3.65M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In 1:4:8 Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Alluminium Sheet Type Iv High Intensity Micro-Prismatic Grade Sheeting 302 Providing And Fixing Informatory Sign Boardsof Size 60 Cm X 80 Cm Made Out Of 3Mm Aluminum Composite Panelbondedwithircspecifiedcolourof Retroreflectivesheetingoftypeivhighintensitymicro- Prismatic Grade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflectivecutoutborder&Messageshavingpressuresensitiveadhesivehavingborder&Messagesinirc Specified Colour Background Including M. S. Angle Iron Frame Of Size 35 Mm X 35 Mm X 5 Mm &M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M-20Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Aluminum Composite Panel With Type Iv High Intensity Micro-Prismatic Grade Sheeting. 303 Providing And Fixing N.H. / S.H. Route Marker Size 60 Cm X 45 Cm With One No. Direction Plate Of Size 30 Cm X 25 Cm Prepared On 16 Gauge M.S. Sheet Including Painting With One Coat Of Zinc Cromate Stoving Primer And Two Coats Each Of White And Green Back Ground And Back Side Gray Stove Enamelled, Bonded With Cut Out Of Red Retro Reflective Sheet Engineering Grade, Border / Letters / Numerals And Arrow, Coated With Non Pealable Crystal Clear Protective Transparent Coat Retaining 100% Reflection Including One Number Of M.S. Angle Iron Post Of Size 50 X 50 X 5 Mm Of 3.65 M. Long Inflated At Bottom Drilled On Top In One Piece Without Joint Painted With White And Black Bands Of 30 Cm. Fixing Board And Post With 4 Nos. Of High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Including All Taxes, Conveying, Fixing In Ground With Cement Concrete 1:4:8 Blockof60cm X60cmx75cm Sizeasdirectedbyengineer-In-Chargeetc.Complete.Mildsteelroute Marker With Engineering Grade 304 Providing And Fixing N.H. / S.H. Route Marker Size 60 Cm X 45 Cm With One No. Direction Plate Of Size 30 Cm X 25 Cm Prepared On 16 Guage Alluminium Sheet Including Type Iv Highintensity Micro-Prismatic Grade Sheeting ( Hip ) Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutout Border&Messageshavingpressuresensitiveadhesivehavingborder&Messagesinircspecifiedcolour Background, Including One Number Of M.S. Angle Iron Post Of Size 50 X 50 X 5 Mm Of 3.65 M. Long Inflated At Bottom Drilled On Top In One Piece Without Joint Painted With White And Black Bands Of 30 Cm. Fixing Board And Post With 4 Nos. Of High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Including All Taxes, Conveying, Fixingingroundwithcementconcrete1:4:8Blockof60cmx60cmx75cmsizeas Directedbyengineer-In-Chargeetc.Complete.Alluminiumsheettypeivhighintensitymicro-Prismatic Grade Sheeting 305 Providing And Fixing Road Junction / Information Sign Board Of Size 1.20 M X 0.90 M. Prepared On 16 Gaugem.S. Sheet With Angle Iron Frame Of Size 35 X 35 X 5 Mm With Cross Bracing Of Size 35 X 35 X 5 Mm Including Painting Withone Coat Of Zinc Cromate Stoving Primer Andtwo Coats Eachof Green / White Back Groundand Backside Graystove Enamelled, Bondedwithredretroreflective Sheet Engineering Grade, Border / Letters / Numeral / Arrows, Coated With Non Pealable Crystal Clear Protective Transperent Coat Retaining 100% Reflection Includingtwo Angle Ironpost Of Size 65X65x6mm Of 3.65M. Long Inflatedat Bottom Drilledontopand Painted In Whiteand Black Bands Of 30 Cm. With 4 Nos. High Strength G.I. Bolts And Nuts Of Size 10 Mm Dia. And 20 Mm Long Sheet And Angle Iron Post In One Piece Without Joints Including All Taxes, Conveying, Fixing In Ground With M-20 Cement Concrete Of 60 Cm X 60 Cm X 75 Cm Size As Directed By Engineer-In- Charge Etc. Complete. Mild Steel Sheet With Engineering Grade. 306 Providing Andfixing Informatorysignboardsinrectangularshape Ofsize1.20M X0.90M Madeoutof16 Guagealuminumpanelbondedwithircspecifiedcolourof Retroreflectivesheetingoftypeivhigh Intensitymicro-Prismaticgradesheeting ( Hip ) Havingpressuresensitive / Heatactivatedadhesive, Irc Specified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Background Including M. S. Angle Iron Frame Of Size 35 Mm X 35 Mm X 3 Mm & Two M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M-20Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete.Aluminum Panel Type Iv High Intensity. 307 Providing And Fixing Informatory Sign Boards In Rectangular Shape Of Size 1.20M X 0.90M Made Out Of 3Mm Aluminum Composite Panel Bonded With Irc Specified Colour Ofretro Reflective Sheeting Of Type Iv High Intensitymicro-Prismaticgradesheeting ( Hip ) Havingpressuresensitive / Heatactivatedadhesive, Irc Specified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Background Including M. S. Angle Iron Frame Of Size 35 Mm X 35 Mm X 3 Mm & Two M.S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.65 M Long, Duly Paintedwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M-20 Concreteblockofsize60cmx60cmx75cmincludingtransportationetc;Complete. Aluminum Composite Panel Type Iv High Intensity. 308 Providing And Fixing Informatory Sign Boards In Square Or Rectangular Shape Of Any Size For Overhead Gantries Or Alike Made Out Of 3Mm Aluminum Composite Panel Bonded With Irc Specified Colour Ofretro Reflective Sheeting Of Type Xi Diamondgrade Sheeting ( Dg3 ) Withecf ( Electronic Cutable Film ) Lettring Having Pressure Sensitive / Heat Activated Adhesive, Irc Specified Colour Retro Reflective Cutout Border & Messages Having Pressure Sensitive Adhesive Having Border & Messages In Irc Specified Colour Background Includingm. S. Angle Iron Frame And Bracing Of Size 35 Mm X 35 Mm X 5 Mm Andduly Paintedwith Flat Oil Paint Includingg.I.Fixturesetc.Andfixingtheboards. ( Theworktobeexecutedwithpriorapprovalof Superintending Engineer. ) 309 Providing And Casting In Situ Or Precast Tapering R.C.C. M-20 Barrier Type Kerb Without Gutter ( As Per Irc 86 1983 ) Embedded 125Mm Below Ground Level Over M-10 Pcc Finished Neatly With C.M. 1:2, Setting The Same In C.M. 1:2, Including The Required Excavation In Any Strata And Removing The Excavated Stuff Any Where In City And Redoing The Surface As Specified And Directed By Engineering In-Charge. Using Concrete Batching Andmixi Plt 310 Providing And Casting In Situ Or Precast Tapering R.C.C. M-20 Semi Barrier Type Kerb Without Gutter ( As Per Irc 86 1983 ) Embedded 125Mm Below Ground Level Over M-10 Pcc Finished Neatly With C.M. 1:2, Setting The Same In C.M. 1:2, Including The Required Excavation In Any Strata And Removing The Excavated Stuff Any Whereincityandredoingthesurfaceasspecifiedanddirectedbyengineeringin-Charge.Usingconcretebatchin And Mixin Plant 311 Providing And Casting In Situ Or Precast Tapering R.C.C. M-20 Mountabletype Kerb Without Gutter ( As Per Irc 86 1983 ) Embedded 125Mm Below Ground Level Over M-10 Pcc Finished Neatly With C.M. 1:2, Setting The Same In C.M. 1:2, Including The Required Excavation In Any Strata And Removing The Excavated Stuff Any Whereincityandredoingthesurfaceasspecifiedanddirectedbyengineeringin-Charge.Usingconcretebatching And Mixing Plant 312 Providing And Casting In Situ Or Precast Tapering R.C.C. M-20 Barrier Type Kerb With Gutter ( As Per Irc 86 1983 ) Embedded 125Mm Below Ground Level Over M-10 Pcc Finished Neatly With C.M. 1:2, Setting The Same In C.M. 1:2, Including The Required Excavation In Any Strata And Removing The Excavated Stuff Any Where In City And Redoing The Surface As Specified And Directed By Engineering In-Charge. Using Concrete Batching Andmixi Plt 313 Providing And Casting In Situ Or Precast Tapering R.C.C. M-20 Semi Barrier Type Kerb With Gutter ( As Per Irc 86 1983 ) Embedded 125Mm Below Ground Level Over M-10 Pcc Finished Neatly With C.M. 1:2, Setting The Same In C.M. 1:2, Including The Required Excavation In Any Strata And Removing The Excavated Stuff Any Where In City And Redoing The Surface As Specified And Directed By Engineering In-Charge. Using Concrete Batchingd Mixi Plt 314 Providing And Casting In Situ Or Precast Tapering R.C.C. M-20 Mountabletype Kerb With Gutter ( As Per Irc 86 1983 ) Embedded 125Mm Below Ground Level Over M-10 Pcc Finished Neatly With C.M. 1:2, Setting The Same In C.M. 1:2, Including The Required Excavation In Any Strata And Removing The Excavated Stuff Any Where In City And Redoing The Surface As Specified And Directed By Engineering In-Charge.Using Concrete Batchingand Mixing Plant 315 Providing And Fixing In Position Guard Railing As Per Drg. No. 15 Type C Dt. 20-4-79, With 3 Rows Of 50Mm Dia. G.I. Pipe 30Cm A Part And Fixed In M.S. Channels Of Section 125 X 65 X 6 Mm Spaced 2.5 C / C 1:2:4 C.C. Bedding Of Size 45 X 30Cm. As Per Detailed Drawing, With 3 Coats Of Approved Yellow And Black Paint Includingnecessary Excavation In Any Trata 316 Providing And Fixing In Position Guard Railing As Per Drg. No. 15 Type C Dt. 20-4-79, With 3 Rows Of 40Mm Dia. G.I. Pipe 30Cm A Part And Fixed In M.S. Channels Of Section 100 X 50 X 6 Mm Spaced 2.5 C / C 1:2:4 C.C. Bedding Of Size 45 X 30 X 30Cm. As Per Detailed Drawing, With 3 Coats Of Approved Of Yellow And Black Paintincluding Necessary Excavation In Any Strata 317 Providing And Fixing Guard Railing Of 1000Mm Height As Per Type D Drg. No. 15 Dt. 20-4-79, And Fixed In 40X 40 X 6Mm Iron, Angle Embedded In 1:2:4 Cement Concrete Bedding Patti As Per Detailed Drawing, With 3 Coats Of Approved Of Yellow And Black Paint 318 Providing And Fixing Guard Railing Of 1000 Mm Height In 25Mm M.S. Square Bars 100 Mm C / C. As Per Type Drawing No. 6 Dt. 20-8- 85 And Fixed In 50Mm X 50Mm X 6Mm Iron Angle Embedded In 1:2:4 C.C. Bedding 55 X 45 Cm And 50 X 6 Iron Patti As Per Detailed Drawing With 3 Coats Of Approved Yellow And Black Paint. 319 Design Of Overlay For Existing B.T. Surface With Carrying Out Testing By Benkelman Beam Method As Per Guide Lines In Irc 81:1997 Including Design And Testing At Site. The Charges For Transportation Of Benkelman Beam, Loaded Truck, Labour For Testing And Traffic Control Are Not Included. 320 Carryingoutroughnessindex / Roadunevennesstestwithcarmounted / Jeeptowedarurmachine ( Automaticroadunevennessrecorder ) Calibratedfromc.R.R.I.Newdelhi ( Centralroadresearch Institute ) Or Any Other Equivalent Authority Including Taking Observations, Feeding Data And Giving Computerized Test Result Including Hire Charges Of All Machinery And Labour Completed. I ) Road Surface Singlelane ( B Tw, B.M. ) 3 75 M Width 321 Carryingoutroughnessindex / Roadunevennesstestwithcarmounted / Jeeptowedarurmachine ( Automaticroadunevennessrecorder ) Calibratedfromc.R.R.I.Newdelhi ( Centralroadresearch Institute ) Or Any Other Equivalent Authority Including Taking Observations, Feeding Data And Giving Computerized Test Result Including Hire Charges Of All Machinery And Labour Completed. I ) Road Surface Singlel ( B Tw, B.M. ) 5 5T 7 00Width 322 Carryingoutroughnessindex / Roadunevennesstestwithcarmounted / Jeeptowedarurmachine ( Automaticroadunevennessrecorder ) Calibratedfromc.R.R.I.Newdelhi ( Centralroadresearch Institute ) Or Any Other Equivalent Authority Including Taking Observations, Feeding Data And Giving Computerized Test Result Including Hire Charges Of All Machinery And Labour Completed. I ) Road Surface Singlelan ( B Tw, B.M. ) Each Additional Lane Width 323 Deadjourneychargesfortransportationofmachine / Vehicalforcarryingoutroughnessindex / Road Unevennesstestwithcarmounted / Jeeptowedarurmachine ( Automaticroadunevennessrecorder ) Calibratedfromc.R.R.I.Newdelhi ( Centralroadresearch Institute ) Oranyotherequivalentauthority Including Taking Observations, Feeding Data And Giving Computerized Test Result Including Hire Charges Of All Machinery And Labour Completed. Spec. No. : As Directed By Engineer In Charge. 324 Providing Andlaying A Wovenpolypropylene Geotextile Of Type-I Manufacturedfrom Black Uvstabilised Polypropylene Tape Yarn On The Prepared Subgrade As The Separator Cum Reinforcement With Necessary Overlapas Per Drawing ( For Use This Item Se / Ce Permission Is Obligatory ) 325 Providing And Laying A Woven Polypropylene Geotextile Of Type-Ii Manufactured From Black Uv Stabilised Polypropylene Tape Yarn On The Prepared Subgrade As The Separator Cum Reinforcement With Necessary Overlapas Per Drawing ( For Use This Item Se / Ce Permission Is Obligatory ) 326 Providing And Laying A Woven Polypropylene Geotextile Of Type-Iii Manufactured From Black Uv Stabilised Polypropylene Tape Yarn On The Prepared Subgrade As The Separator Cum Reinforcement With Necessary Overlapas Per Drawing. ( For Use This Item Se / Ce Permission Is Obligatory. ) 327 Providing And Laying A Fibre Glass Geogrid Of Tensile Strength 50 Kn / M Manufactured From High Quality Glassfibrestrandsandcoatedwithapolymermodifiedbitumenasreinforcementtoasphaltoverlayflexible Pavements And Asphalt Over Distressed Rigid P.C.C. 328 Providing And Laying A Fibre Glass Geogrid Of Tensile Strength 100 Kn / M Manufactured From High Quality Glassfibrestrandsandcoatedwithapolymermodifiedbitumenasreinforcementtoasphaltoverlayflexible Pavements And Asphalt Over Distressed Rigid P.C.C. 329 Providing And Constructing Gabion Structure 1 Meter High Or Required Section Made Up Of Soft Mechanically Wovenhexagonalshapedg.I.Wireconfirming Tois16014:2012Having Zincpluspvccoating Ofoverall Diameter Of 3.7 Mm And Tying Lacing Wire Of 3.2 Mm With Edge Wire Confirming To Overall Diameter 4.4 Mm Edges Being Mechanically Selvedge Including Placing In Position, Fitting Neatly With Trap Stone Rubble ( 15 To 23 Cm ) All Loose Ends To Be Securely Tied ( Excluding Transportation ) Etc. Complete. ( In Dry Condition And For Under Water Installation Extra Cost To Be Considered ) 330 Providing And Constructing Gabion Structure0.50 Meter High Or Required Section Madeup Of Soft Mechanically Woven Hexagonal Shaped G.I. Wire Confirming To Is 16014:2012 Having Zinc Plus Pvc Coating Of Overall Diameter Of 3.7 Mm And Tying Lacing Wire Of 3.2 Mm With Edge Wire Confirming To Overall Diameter4.4 Mm Edges Being Mechanically Selvedge Including Placing In Position, Fitting Neatly With Trap Stone Rubble ( 15 To 23 Cm ) All Loose Ends To Be Securely Tied ( Excluding Transportation ) Etc. Complete. ( In Dry Condition And For Under Water Installation Extra Cost To Be Considered ) 331 Providingandlayingneedlepunched Andmechanically Bonded Non Wovengeotextileoftype Iii Indigenouslymanufacturedfromhighqualitypropylenestaplefibers ( Continuousfilamentwillnotbe Accepted ) On The Prepared Subgrade For Seperation. ( For Use This Item Se / Ce Permission Is Obligatory. ) 332 Providing And Layingneedle Punched And Mechanically Bonded Non Woven Geotextile Of Type Ii Indigenouslymanufacturedfromhighqualitypropylenestaplefibers ( Continuousfilamentwillnotbe Accepted ) On The Prepared Subgrade For Seperation. ( For Use This Item Se / Ce Permission Is Obligatory. ) 333 Removal Of Telephone / Electric Poles Including Excavation And Dismantling Of Foundation Concrete And Lines Under The Supervisionof Concerneddepartment, Disposal Withall Lifts And Upto A Lead Of 1000 Metres Andstacking The Serviceable And Unserviceable Material Separately 334 Footpaths And Separators -- Construction Of Footpath / Separator By Providing A 150 Mm Compacted Granular Sub Base As Per Clause 401 And 25 Mm Thick Cement Concrete Grade M15, Over Laid With Pre-Cast Concrete Tiles In Cement Mortar 1:3 Including Provision Of All Drainage Arrangements But Excluding Kerb Channel. 335 Metal Beam Crashbarrier -- Type - A, W : Metal Beam Crashbarrier ( Providing And Erecting A W Metal Beamcrashbarriercomprisingof3mmthickcorrugatedsheetmetalbeamrail, 70Cm Aboveroad / Ground Level, Fixed On Ismc Series Channel Vertical Post, 150 X 75 X 5 Mm Spaced 2 M Centre To Centre, 1.8 M High, 1.1 M Below Ground / Road Level, All Steel Parts And Fitments To Be Galvanised By Hot Dip Process, All Fittings To Conform To Is:1367Andis:1364, Metal Beam Rail To Be Fixedonthe Vertical Post Witha Spacer Of Channel Section 150 X 75 X 5 Mm, 330 Mm Long Complete As Per Clause 810 ) 336 Metal Beam Crash Barrier -- Type - B, Thrie : Metal Beam Crash Barrier ( Providing And Erecting A Thrie Metalbeamcrashbarriercomprisingof3mmthickcorrugatedsheetmetalbeamrail, 85Cmabove Road / Ground Level, Fixed On Ismc Series Channel Vertical Post, 150 X 75 X 5 Mm Spaced 2 M Centre To Centre, 2 M High With 1.15 M Below Ground Level, All Steel Parts And Fitments To Be Galvanised By Hot Dip Process, All Fittings To Conform To Is:1367 And Is:1364, Metal Beam Rail To Be Fixed On The Vertical Post With A Space Of Channel Section 150 X 75 X 5 Mm, 546 Mm Long Complete As Per Clause 810 ) 337 Flexiblecrashbarrier, Wireropesafetybarrier ( Providinganderectingawireropesafetybarrierwith Vertical Posts Of Medium Weight Rs Joist ( Ismb Series ) 100 Mm X 75 Mm ( 11.50 Kg / M ) , 1.50 M Long 0.85 M Above Ground And0.65 M Below Groundlevel, Split At The Bottom For Better Grip, Embedded Inm 15Grade Cement Concrete 450 X 450 X 450 Mm, 1.50 M Center To Center And With 4 Horizontal Steel Wire Rope 40 Mm Dia Andanchoredatterminalposts 15M Apart.Terminal Postto Be Embeddedinm 15Grade Cementconcrete Foundation 2400 X 450 X 900 Mm ( Depth ) , Strengthened By A Strut Of Rs Joist 100 X 75 Mm, 2 M Long At 450 Inclinationandatie 100X8mm, 1.50M Long Atthe Bottom, Allembeddedinfoundationconcrete Asper Approved Design And Drawing, Rate Excluding Excavation And Cement Concrete. ) 338 Anti - Glare Screen With 25 Mm Steel Pipe Framework Fixed With Circular And Rectangular Vans ( Providing And Erecting An Anti - Glare Screen With 25 Mm Dia Vertical Pipes Fabricated And Framed In The Form Of Panels Of One Metre Length And 1.75 Mtr Height Fixed With Circular Vane 250 Mm Dia At Top And Rectangular Vane 600 X 300 Mm At The Middle, Made Out Of Steel Sheet Of 3 Mm Thickness, End Vertical Pipes Of The Panel Made Larger For Embeddinginfoundationconcrete, Applying2coatsofpaintonallexposedsurfaces, Allasperapproveddeign And Drawing ) 339 Anti-Glarescreenwithrectangularvaneofmssheet ( Providinganderectinganti-Glarescreenwith Rectangular Vanes Of Size 750 X 500 Mm Made From Ms Sheet, 3 Mm Thick And Fixed On Ms Angle 50 X 50 X 6 Mm At An Angle Of 450 To The Direction Of Flow Of Traffic, 1.5 M Center To Center, Top Edge Of The Screen 1.75 M Above Ground Level, Vertical Post Firmly Embedded In Cement Concrete Foundation 0.60 M Below Ground Level, Applying 2 Coats Of Paint On Exposed Faces, All Complete As Per Approved Design And Drawings ) 340 Providing Reinforced Cement Concrete Crash Barrier At The Edges Of The Road, Approaches To Bridge Structures And Medians, Constructed Withr.C.C. M 20 Grade Concrete With Hysd Reinforcement Conforming To Irc:21 Anddowelbars25mm Dia, 450Mm Long Atexpansionjointsfilledwithpre-Mouldedasphaltfillerboard, Keyed To The Structure On Which It Is Built And Installed As Per Design Given In The Enclosure To Most Circular No.Rw / Nh-33022 / 1 / 94-Doiiidated24june1994asperdimensionsintheapproveddrawingandat Locations Directed By The Engineer, All As Specified Etc. Complete. Spec: Mort And H 2013 Cl 811 Page No360 341 Providing Reinforced Cement Concrete Crash Barrier At The Edges Of The Road, Approaches To Bridge Structures And Medians, Constructed Withr.C.C. M 25 Grade Concrete With Hysd Reinforcement Conforming To Irc:21 Anddowelbars25mm Dia, 450Mm Long Atexpansionjointsfilledwithpre-Mouldedasphaltfillerboard, Keyed To The Structure On Which It Is Built And Installed As Per Design Given In The Enclosure To Most Circular No.Rw / Nh-33022 / 1 / 94-Doiiidated24june1994asperdimensionsintheapproveddrawingandat Locations Directed By The Engineer, All As Specified Etc. Complete. Spec: Mort And H 2013 Cl 811 Page No360 342 Providing Reinforced Cement Concrete Crash Barrier At The Edges Of The Road, Approaches To Bridge Structures And Medians, Constructed Withr.C.C. M 30 Grade Concrete With Hysd Reinforcement Conforming To Irc:21 Anddowelbars25mm Dia, 450Mm Long Atexpansionjointsfilledwithpre-Mouldedasphaltfillerboard, Keyed To The Structure On Which It Is Built And Installed As Per Design Given In The Enclosure To Most Circular No.Rw / Nh-33022 / 1 / 94-Doiiidated24june1994asperdimensionsintheapproveddrawingandat Locations Directed By The Engineer, All As Specified Etc. Complete. Spec: Mort And H 2013 Cl 811 Page No360 343 Labour For Filling Pot Holes With Premix Asphalt Chips, Cleaning The Road Surface With Wire Brushes And Gunny Bags, Applying Tack Coat, Spreading Mixture Hand Ramming Or Light Compaction With Power Roller Conveying Material To The Site Of Work ( Excluding Cost And Of Material Fuel And Heating Asphalt ) Etc Complete. 344 Labourformetalpatchrepairsincluding Preparingsurface, Addingrequiredquantityofmetal, Murum, Watering, Rammingetccomplete.Spec.No.:Asdirectedbyengineer-In-Charge. ( Excludingcostandofmaterial ) 345 Restoration Of Rain Cuts With Soil, Murum Gravel Or A Mixture Of These, Clearing The Loose Soil, Benching For 300Mm Width Laying Fresh Material In Layers Not Exceeding 250 Mm And Compaction With Plate Compactor Or Power Rammer To Restore The Original Alignment, Level And Slopes As Per Drawings And Morth Specificationl3002 346 Making Up Loss Of Material / Irregularities On Shoulders To The Design Level By Adding Fresh Approved Selected Soil And Compacting It With Appropriate Equipment At Omcas Per Morth Specification Clause 3003 347 Strippingexcesssoilfromtheshouldersurfacetoachievetheapprovedlevelandcompactingwithplatecompactor At Omc As Per Drawingsas Per Morth Specification Clause 3003 348 Repairtopotholesbyremovaloffailedmaterial, Trimmingthesidestoverticalandlevellingthebottom, Cleaning The Same With Compressed Air Or Any Appropriate Method Filled With 75Mm B.M, Applying Bitumen Tack Coat At The Bottom And Vertical Sides As Per As Per Morth Specification Clause 3004.1 And 3004.2 349 Patch Repair On Already Filled Pot Holeswith 20 Mm Premix Carpet Andseal Coat As Per Morth Specificationclause 3004.1 And 3004.2 350 Repair To Pot Holes And Removal Of Loose Material, Trimming Of Sides, Cleaning Of Surface By Providing Tack Coat, 20 Mm Thick Pre-Mix Carpet And Seal Coatas Per Morth Specification Clause 3004.1 And 3004.2 351 Maintenance Of Gravel Road Including Making Up The Loss Of Profile, Rectifying Corrugated Surface, Filling Up Of Depressions, Potholesanderosiongulliesbyaddingfreshmaterialandcompactingitwithappropriate Equipmentor To Stripexcess Of Material From The Road Surface As Per Drawings Etc Complete 352 Providing Pick Androll Surface By Pickingthe Oldwbmsurface To The Requiredstandard, Adding 30%Of 40Mmsizemetalandrequiredquantityofmurumincludinglayingsectioning, Watering, Compactingwith Staticrollerwiththinlayerofmurumblindageoncarrageway, Wateringandcompactingbystaticroller, Including Cost Of All Materials, Loading, Unloading, Stacking And Labour Etc. Complete. Spec.No. : As Directedby Engineer- In-Chare. 353 Maintenance Of Wbm Road Including Filling Up Of Pot Holes, Ruts And Rectifying Corrugated Surface, Damagededges And Ravelling Etc. Complete 354 The Maintenance Of Drains Include Erosion, Repair, Clearing, Cleaning, Reshaping, Regrading, Deepening Of Sidedrains As Well As Catch Water Drains Etc. Complete 355 Maintenance Of Hume Pipe Culvert By Way Ofclearing, Cleaning, Erosion Repair, Repairs To Cracks, Parapetwall And Protection Work As Per Drawing Etc. Complete 356 Maintenanceofroadsignsbywayofcleaningandrepaintingofmandatory / Requlatory / Cautionary / Informatory And Place Identifications Sign Board As Per Drawings Etc. Complete 357 Maintenanceofkilometerstones, And200metre Bywayofrefiting Oftiltedstonesrepairing Withcement Mortar, Cleaning, Repairing And Lettering On 200 Metre Km Stone And5th Km Stone Etc. Complete 358 Cutting Of Branches Of Trees And Shrubs From The Road Way Or With In R.O.Wincluding Disposal Of Wood Andleaves To Suitable Location Etc. Complete 359 Trimmingofgrass, Shurbsandweedsfromtheshoulders / Bermsanddisposingoffthesametosuitablelocations Etc. Complete 360 Maintenance Of Guardstones / Boundrystones / Indicatorstones Byway Ofrefiting Oftiltedstonesrepairingwith Cement Mortarcleaningrepairing And White Washing Etc. Complete 361 Repair Of Steel Railing To Bring It To Original Shape Cleaning And Repainting As Per Drawing Etc. Complete 362 Repair Of Rcc Railing To Bring It To The Original Shape, Cleaning And Repainting As Per Drawings Etc. Complete 363 Removal Of Steel Railing And Refixing Of Railingto Submersible Bridges Including Cleaning And Repainting Etccomplete 364 White Washing Two Coats On Parapet Walls And White Washing And Geru Lime Painting To Tree Trunks Includingpreparation Of Surface By Cleaning Scrapingetc. Complete 365 Dressing Ofside Shoulder / Scrapping The Roadside Shoulderby Mechanicalmeans ( Byjcb / Douzer ) Including Excavation Of Raised Side Shoulders Upto 15Cm Depth Including Remooving / Cutting Bushes, Grass And Dressing Shoulder To Desired Camber And Disposing Of Excavated Stuff Up To Road Boundary Etc Complete. Asdirected By Engineer In Charge 366 Providingandlayingpressuresensitivetechnology ( Pst ) Basedinsstapattchreadymixcompoundfor Repairpotholes, Manufacturedfromaggregatesof4-12Mm, Treatedwithspecialgradebitumen, Pressure Sensitive Polymer ( Psp ) Andcross Linking Chemical ( Clc ) Agents Etc, Technically Evaluated For Repairs On Bitumenous / Concrete Surfaces, Confirming To Crri And Irc Accreduted Norms For Pressure Sensitive Polymer Products For Repairs Of Potholes On Road / Pavements, Havinfg Upto 25Mm Thick Insstapattch Layer On Base Of Compacted Aggregates ( Crusher Brocken ) Of 50Mm Thickness Including Labours, Material, Tools And Tampering Etc Complete. 367 Providing, Laying Androlling Micro Seal Surfacing ( 10Mm Thick ) For Preventive Maintainance Including Supplying All Materials , Preparing The Existing Road Surface , Heating Bitumen , Aggregates , Lime In Hot Mix Plant , Laying The Mix Seal Surfacing By Paver Finisher And Compaction By Power Roller Etc Complete. ( Using 60 / 70 Bulk Bitumen For Mixing And Tack Coat Over Black Topped Surface By Using 0.14 Cum Per 10 Sqm. Of Crusher Aggregate Passing 100 % Through 6.30 Mm Sieve And Retained100 % On 0.075 Mm Size Sieve 0.2 Kg / Sqm Lime And 11.00 Kg / 10 Sqm Bulk Bitumen For Fixing And 0.50 Kg / Sqm For Tack Coat ) Spec: As Directed By Engineer In Charge And Irc Sp 78 - 2008 368 Providing, Laying Androlling Micro Seal Surfacing ( 10Mm Thick ) For Preventive Maintainance Including Supplying All Materials , Preparing The Existing Road Surface , Heating Bitumen , Aggregates , Lime In Hot Mix Plant , Laying The Mix Seal Surfacing By Paver Finisher And Compaction By Power Roller Etc Complete. ( Using 60 / 70 Bulk Bitumen For Mixing And Tack Coat Over Black Topped Surface By Using 0.14 Cum Per 10 Sqm. Of Crusher Aggregate Passing 100 % Through 9.50 Mm Sieve And Retained100 % On 0.075 Mm Size Sieve 0.2 Kg / Sqm Lime And 9.50 Kg / 10 Sqm Bulk Bitumen For Fixing And 0.50 Kg / Sqm For Tack Coat ) Spec: As Directed By Engineer In Charge And Irc Sp 78 -2008 369 Providing And Laying Shoulder Drain Of Trap Rubble Of 0.45 X 0.45 Meter Section At 45 Degree Angle To The Road Edge Including Hand Packing, Filling Voids With Sand / Shingle Of Approved Quality And Ramming Etc. Completeas Desired. 370 Providingandlayingpressuresensitivetechnology ( Pst ) Basedreadymixcompoundforrepairing Potholes, Manufactured From Aggregates Of 4-12Mm, Treated Compound Having Mix Of Bituminous Antistriping Compound, Stabilizer, Pressure Sensitive Polymer And Water Repellent Compound Like Oil Soluble Polyacid Etc. Havinggood Consistencyforlaying, Technicallyevaluatedforrepairsonbituminous / Concretesurface Confirmingtocrriandircaccrediatednormsforpressuresensitivepolymerproductsforrepairsfo Potholes Onroad / Pavement Having Upto 25Mm Thick Ready Thickness Including Labours, Material, Tools And Tampering Etc. Complete. ( Undertaking Shall Be Taken From The Supplier Before Starting The Work ) 371 Supply Of Self Watering System Multi Stage Tree Guard / Protctor 110 Mm Dia & Total Height Of 1800 Mm Made Up With Hdpe. In Tubular Section, First Stage Will Be 600Mm Long & Second And Forth Stage 65% Perforated Casting In Hdpe Tubular Section Of 300Mm Long Each Tubular Section & Third And Fifth Stage Of Plain 300Mm Long Each Tubular Section In 110Mm Dia. All Sections Fix With Stagewise With Leakproof Fixing Arrangement 2 No Tubular Rubber Section Of75mm Dia, 1.5Mm Thick & Length 350 Mm ( Fix On Both 65% Perforated Tubular Section At Top For Increase The Water Holding Capacity As Per Plant Height ) . The Specially Designed Rubber Water Holding Device Of Size 90Mm Dia Outerside & 12Mm Dia Innerside Of 1.5Mm Thick As Per Design Fix On 40Mm Dia. 100Mm Long Pvc Pipe Seperately. ( For Inserting The Plants ) . 2 Nos 40Mm Dia. Treated Bamboo Of 2.00 Mtr. Height ( Buried 150 Mm Below The Bottom Of Excavated Pit & Stand With Tubular Section ) 2 Nos Rubber / Pvc Ties ( Fix At Bottom & Top Of Plain Tubular Section With Bamboo ) 2 Nos 5Mm Dia. Fromate ( Fixing At Bottom O Tubular Sectionfordeeprootirrigationsystem ) 2Nos600mm Long Hdpelateralpipe Of5mm Dia.Withdeeproori I ( I Ihpi200fl00l B Bd 372 Supply Of Self Watering System Tree Guard In 110 Mm Dia, 1.80 Mt Height Made Up Of Cotton Canvas Cloth Of Polymer Pipe Of 15 Litres Water Storage Capacity Stand With 2 Nos. 40 Mm Dia Treated Bamboo Of 2 Mt Ht. Tie With Tag At Two Nos And Specially Designed Dexpandable Rubber Seal 110 Mm Dia Outer & 25 Mm Dia. Inner Dia Installed On Bottom Of Pipe, And 0.60 M Long Hdpe Lateral Pipe 2 Nos 5Mm Dia To Carry The Water Near Root Zone Connected With Gromate Fix In Treeguard And Rapping 1.20M Long Barbed Wire To Middle Of Treeguard For Protection Agianst Cattles And Other External Factors As Per Specification. ( Cost Of Plant & Fixing Charges Will Be Extra As Per Approved Rates ) . ( Note :- Plant Height Should Be Required Above 2.50 M & Dia Of Stem 25 Mm At Bottom ) 373 Fixing And Transporting Of Self Watering System Tree Guard-Insertion Of Sapling In Self Watering Tree Guard And Capping The Bottom With Expandable Rubber Seal. Supporting The Bamboo With The Help Of Cable Tie. Bamboo To Beburied0.15Mtht.Belowofexcavatedpit.Strengtheningthebambooinpitwithadequatemeasures. Circulating The Barbed Wire Around Tree Guard At Middle Ht. From Bottom And Fixing It. Thr Rates Excluding The Cost Of Barbed Wire, Bamboo, Expandable Seal, Tree Guard And All Other Required Material. Fixing To Be Carriedut A Per Manul Intructin 374 Providing50mm Thickfull Groutbituminoustreatmentincludingsupplyingallmaterials, Prepairingthe Exisisting Road Surface, Applying Tack Coat @ 0.735 Kg / Sqm And Laying The Required Thickness Of Metal Layer, Heating And Spraying Bitumen Of Specified Grade At The Rate Of 5.00 Kg / Sqm , Spreading Chips And Laying Seal Coat Of Specified Grade Of Bitumen Of 1.70 Kg / Sqm And Compacting , Making The Surface Good Etc. Complete ( For Only Patch Repair Works / For Roadwork ) ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 375 Providing 50Mm Thicksemi Groutbituminoustreatmentincluding Supplying Allmaterials, Prepairing The Exisisting Road Surface, Applying Tack Coat @ 0.735 Kg / Sqm And Laying The Required Thickness Of Metal Layer, Heating And Spraying Bitumen Of Specified Grade At The Rate Of 2.75 Kg / Sqm , Spreading Chips And Laying Seal Coat Of Specified Grade Of Bitumen Of 1.25 Kg / Sqm And Compacting , Making The Surface Good Etc. Complete ( For Only Patch Repair Works / For Roadwork ) ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 376 Providing And Constructing 75 Mm. Thick Modifiedpenetraction Macadam ( Mpm ) Road Surface Including All Materials, Preparing The Existing Road Surface, Spreading 40 Mm. Stone Layers Metal 30%Crusher Broken Metal+ 70% Hand Broken Metal ( By Breaking Rubble Obtained By Blasting ) , Heating And Spraying Thebitumen Of Vg-30Grade @2Kg / Sqm , Spreading 12Mm.Size Chipscompacting Withthree Wheelstaticrollerhaving Weight 8To 10Mt. To Achive The Desireddegree Ofcompactionasper Technicalspecificationclause 506 Etc.Complete, Including Applying Tack Coat Of Vg 10 Grade Bitumen At The Rate Of 0.30 Kg Sqm. On Existing Bitumen Surface. ( For Repair Works Only ) 377 Providing And Constructing 50 Mm. Thickmodifiedpenetration Macadam ( Mpm ) Road Surface Including All Materials, Preparing The Existing Road Surface, Spreading 40Mm. Stone Layers Metal 30%Crusher Broken Metal+ 70% Hand Broken Metal ( By Breaking Rubble Obtained By Blasting ) , Heating And Spraying The Bitumen Of Vg-30 @ 1.75 Kg / Sqm, Spreading 12Mm.Size Chips Compacting With Static Roller Having Weight 8 To 10 Mt. To Achive The Desired Degree Of Compaction As Per Technical Specification Clause 506 Etc.Complete, Including Applying Tack Coat At The Rate Of 0.30 Kg Sqm. ( For Repair Works Only ) 378 Providing Rubble Filling Of Trap / Granite / Quartzite Gneiss Stones For Foundations Including Filling Voids Withsand / Grit And Compaction Etc Complete. 379 Providing Andlaying Insitu / Readymixcementconcrete Ofm-10Proportionwithtrap / Granite / Quartzite / Gneissmetalinfoundationincludingnecessaryformwork, Compactingandcuringetc.Complete. ( With Reversible Drum Type Mixer With Scada With Fine Agreegates Of Required Specifications ( Natural Sand / Vsisand Finely Washed Etc ) 380 Providing & Laying In Situ Cement Concrete Of M 10 Proportion With Trap / Granite / Quartzite / Gneiss Metal In Foundation Including Necessary Form Work Compacting And Curing Etc. Complete. With Reversible Drum Typemixer With Scadawith Crushed Sand 381 Providing And Laying In Situ Cement Concrete Of 1:4:8 Proportion With Trap / Granite / Quartzite / Gneiss Metal In Foundation Including Necessary Form Work, Compacting And Curing Etc. Complete. ( With Reversible Drum Type Mixer With Scada With Fine Agreegates Of Required Specifications ( Natural Sand / Vsi Sand Finely Washed Etc ) 382 Providing Rubble Stone Paving 15Cm Thick In 1:3 Cement Mortar Over A Bedding Of 15Cm Thick Cement Concreteof1:4:8Proportionwithtrap / Granite / Quartzite / Gneissmetalincludingstrikingjointsandwateringetc. Complete. 383 Providing Uncoursed Rubble Trap / Quartzite / Gneiss Stone Masonary In Cement Mortar 1:5 For Piers, Abutments, Wings, Returns, Head-Walls, Parapet Etc. Including Bailing Out Of Water, Striking Joints Of The Non Exposed Faces, Pointing The Exposed Faces With Cement Mortar 1:3, Scaffolding, Watering To Masonary And Etc. Complete. 384 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-2 Class Of 450Mm Diameter In Proper Line, Level And Slope Including Providing And Fixing Collars In Cement Mortar 1:2 And Curing Etc. Complete. 385 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-2 Class Of 600Mm Diameter In Proper Line, Level And Slope Including Providing And Fixing Collars In Cement Mortar 1:2 And Curing Etc. Complete. 386 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-2 Class Of 800Mm Diameter In Proper Line, Level And Slope Including Providing And Fixing Collars In Cement Mortar 1:2 And Curing Etc. Complete. 387 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-2 Class Of 900Mm Diameter In Proper Line, Level And Slope Including Providing And Fixing Collars In Cement Mortar 1:2 And Curing Etc. Complete. 388 Providing Andlaying Cement Concrete Pipe Of Is458:2003 Np-2Class Of 1000Mm Diameter In Proper Line, Level And Slope Including Providing And Fixing Collars In Cement Mortar 1:2 And Curing Etc. Complete. 389 Providing Andlaying Cement Concrete Pipe Of Is458:2003 Np-2Class Of 1200Mm Diameter In Proper Line, Level And Slope Including Providing And Fixing Collars In Cement Mortar 1:2 And Curing Etc. Complete. 390 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-3 Class Of 600Mm Diameter In Proper Line, Leveland Slope Etc. Complete. 391 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-3 Class Of 800Mm Diameter In Proper Line, Leveland Slope Etc. Complete. 392 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-3 Class Of 900Mm Diameter In Proper Line, Leveland Slope Etc. Complete. 393 Providing Andlaying Cement Concrete Pipe Of Is458:2003 Np-3Class Of 1000Mm Diameter In Proper Line, Level And Slope Etccomplete 394 Providing Andlaying Cement Concrete Pipe Of Is458:2003 Np-3Class Of 1200Mm Diameter In Proper Line, Level And Slopeetccomplete 395 Providing And Laying Cement Concrete Pipe Of Is 458:2003 Np-4 Class Of 900Mm Diameter In Proper Line, Leveland Slope Etc. Complete. 396 Providing Andlaying Cement Concrete Pipe Of Is458:2003 Np-4Class Of 1000Mm Diameter In Proper Line, Level And Slopeetc. Complete. 397 Providing Andlaying Cement Concrete Pipe Of Is458:2003 Np-4Class Of 1200Mm Diameter In Proper Line, Level And Slope Etc. Complete. 398 Providing Cast In Situ / Ready Mix Block Of M10 Cement Concrete With Circular Or Other Shaped Openingfor Waterwayincludingnecessaryformwork, Compaction, Finishingandcuringetc.Complete. ( Withreversible Drumtypemixer / Concretebatchmixplant ( Panmixer ) Withscadawithfineagreegatesofrequired Specifications ( Natural Sand / Vsi Sand Finely Washed Etc ) , Cement 4.05 Bags / Cumt ) 399 Providing Selected Hard Murum Filling Including Laying In Layers Of 15 To 20Cmwith Watering And Compactingetc. Complete. 400 Providing Andlaying Insitu / Ready Mixm-20Cement Concrete Of Trap / Granite / Quartzite / Gneissmetalfor Approach Slab / Rigid Pavement Including Compacting, Finishing, Curing Etc. Complete. ( Excluding Reinforcement ) ( Withreversible Drum Type Mixer / Concrete Batchmix Plant ( Pan Mixer ) With Scadawith Fine Agreegates Of Required Specifications ( Natural Sand / Vsi Sand Finely Washed Etc ) , Cement 6.40 Bags / Cumt ) 401 Providing And Fixing Stream Lined M-20 Grade Rcc Guard Stone Including Mild Steel Bar Reinforcement Etc.Complete. 402 Providing Cast In Situ / Ready Mix M10 Grade Cement Concrete For Head Walls Of Cd Work / Retaining Walls Etc. Including Necessary Form Work, Compaction, Finishing Andcuring Etc. Complete. ( Withreversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Withscadawithfine Agreegatesofrequiredspecifications ( Natural Sand / Vsi Sand Finely Washed Etc ) , Cement 4.05 Bags / Cumt ) 403 Providing Cast In Situ / Ready Mix M20 Grade Cement Concrete For Head Walls Of Cd Work / Retaining Walls Etc. Including Necessary Form Work, Compaction, Finishing Andcuring Etc. Complete. ( Withreversible Drum Typemixer / Concrete Batch Mix Plant ( Pan Mixer ) With Scada 404 Providing Andcasting Insitu / Ready Mixpccm15grade Of Trap Metal For Copingto Headwalls / Parapet Includingcentering, Formwork, Compactionandcuringetc.Complete. ( Withreversibledrumtypemixer / Concrete Batch Mix Plant ( Pan Mixer ) With Scada With Fine Agreegates Of Required Specifications ( Naturalsand / Vsi Sand Finely Washed Etc ) 405 Providing Andcasting Insitu / Ready Mixpccm20grade Of Trap Metal For Copingto Headwalls / Parapet Includingcentering, Formwork, Compactionandcuringetc.Complete. ( Withreversibledrumtypemixer / Concrete Batch Mix Plant ( Pan Mixer ) With Scada With Fine Agreegates Of Required Specifications ( Naturalsand / Vsi Sand Finely Washed Etc ) 406 Excavation For Foundation In Earth, Soil Of All Types, Sand, Gravel And Soft Murum, Including Removingthe Excavatedmaterialuptoadistanceof50m.Beyondthebuildingareaand Stackingandspreadingas Directed, Dewatering, Preparingthebedforthefoundationand Necessary Back Filling, Ramming, Watering Including Shoring And Strutting Etc. Complete. ( Lift Upto 3.00 M. ) By Manual Means 407 Excavation For Foundation In Earth, Soil Of All Types, Sand, Gravel And Soft Murum, Including Removingthe Excavatedmaterialuptoadistanceof50m.Beyondthebuildingareaand Stackingandspreadingas Directed, Dewatering, Preparingthebedforthefoundationand Necessary Back Filling, Ramming, Watering Including Shoring And Strutting Etc. Complete. ( Lift Upto 1.5 M. ) By Mechanical Means 408 Excavationforfoundationinearth, Soilsofalltypes, Sand, Gravelandsoftmurum, Including Removing The Excavatedmaterial Upto A Distance Of 50Metres Beyondthe Building Areaandstackingand Spreading As Directed, Dewatering, Preparingthebedforthefoundationand Necessary Back Filling, Ramming, Watering Including Shoring And Strutting Etc. Complete. ( Lift From 1.5M To 3.0M ) By Manual Means 409 Excavationforfoundationinearth, Soilsofalltypes, Sand, Gravelandsoftmurum, Including Removing The Excavatedmaterial Upto A Distance Of 50Metres Beyondthe Building Areaandstackingand Spreading As Directed, Dewatering, Preparingthebedforthefoundationand Necessary Back Filling, Ramming, Watering Including Shoring And Strutting Etc. Complete. ( Lift From 1.5M To 3.0M ) By Mechanical Means 410 Excavationforfoundationinhardmurum Includingremovingtheexcavatedmaterialupto Distanceof50metresbeyondthebuildingareaandstackingandspreadingasdirected, Dewatering, Preparingthe Bedforthefoundationandnecessarybackfilling, Ramming, Watering Including Shoring And Strutting Etc. Complete ( Lift Pto 1 50 M ) B Manal Means 411 Excavationforfoundationinhardmurum Includingremovingtheexcavatedmaterialupto Distanceof50metresbeyondthebuildingareaandstackingandspreadingasdirected, Dewatering, Preparingthe Bedforthefoundationandnecessarybackfilling, Ramming, Wateringincludingshoringandstrutting Etc.Complete. ( Liftupto1.50M ) Bymechanical Means 412 Excavation For Foundation In Hard Murum Including Removing The Excavated Material Upto A Distanceof50 Metresbeyondthebuildingareaandstackingandspreadingasdirected, Dewatering, Preparingthebed For Thefoundation Andnecessarybackfilling, Ramming, Watering Including Shoring Andstrutting Etc. Complete. ( Liftfrom 1.5To 3.0M ) By Manual Means 413 Excavation For Foundation In Hard Murum Including Removing The Excavated Material Upto A Distanceof50 Metresbeyondthebuildingareaandstackingandspreadingasdirected, Dewatering, Preparingthebed Forthefoundationandnecessarybackfilling, Ramming, Wateringincludingshoringand Struttingetc. Complete. ( Lift From1.5 To3.0M. ) By Mechanical Means 414 Excavationforfoundationinhardmurumandbouldersincludingremovingtheexcavated Material Up Toadistance50metres, Beyondthebuildingareaandstackingandspreadingasdirected, Dewatering, Preparingthebedforthefoundationandnecessarybackfilling, Ramming, Wateringincludingshoring Andstruttingetc.Complete. ( Liftupto1.5M. ) By Mechanical Means 415 Excavationforfoundationinhardmurum Andbouldersincludingremoving Theexcavated Material Upto Adistanceof50metres, Beyondthebuildingareaandstackingandspreadingasdirected, Dewatering, Preparingthebed For Thefoundation And Necessaryback Filling, Ramming, Watering Including Shoring And Strutting Etc. Complete. ( Lift From 1.5 M To 3.0 M. ) By Mechanical Means 416 Excavation For Foundation In Soft Rock And Old Cement Or Lime Masonry Foundations Including Removing The Excavated Material Upto A Distance Of 50 Metres Beyond The Building Area And Stacking As Directed, Including Dewatering, Preparingthebedforthefoundationandnecessarybackfillingwithavailableearth / Murum, Ramming, Watering Including Shoring And Strutting Etc. Complete ( Lift Upto 1.5M ) By Mechanical Means 417 Excavation For Foundation In Soft Rock And Old Cement Or Lime Masonry Foundations Including Removing The Excavated Material Upto A Distance Of 50 Metres Beyond The Building Area And Stacking As Directed, Including Dewatering, Preparingthebedforthefoundationandnecessarybackfillingwith Availableearth / Murum, Ramming , Watering Including Shoring Andstrutting Etc. Complete. ( Lift From 1.5M To 3.0 M. ) By Mechanicalme 418 Excavationfor Foundationinhardrock By Blasting Including Trimming Andleveling The Bedby Chiseling Where Necessary And Removing The Excavated Material And Stacking It Inmeasurableheapswithina Distanceof50metresfromthebuildingareaincludingdewateringand Back Filling With Available Earth / Murum, Watering, Ramming, Etc.Complete. ( Liftupto 1.5M ) By Mechanical Means 419 Excavation For Foundation In Hard-Rock By Blasting Including Trimming And Leveling The Bed Bychiselling Where Necessary And Removing The Excavated Material And Stacking It Inmeasurableheapswithina Distance Of 50 Metres From The Building Area Including Dewatering And Back Filling With Available Earth / Murum Watering, Ramming Etc. Complete. ( Lift From 1.5M To 3.0 M ) By Mechanical Means 420 Excavationforfoundationinhard-Rockbycontrolledblastingincludingtrimmingand Levelingthebed By Chiselling Where Necessary And Removing The Excavated Material Andstacking It In Measurable Heapswithinadistanceof50metres.Fromthebuildingarea Including Dewatering And Back Filling With Available Earth Soil / Murum Watering, Ramming Etc. Complete. ( Lift Upto 1.5M ) By Mechanical Means 421 Excavation For Foundation Inhardrock By Chiselling, Wedging, Line Drilling, Etc. Including Trimming And Levelling The Bed, Removing The Excavated Material Upto A Distance Of 50 Metres Beyond Thebuildingarea Stacking As Directed, Dewatering And Back Filling With Availableearth / Murumwatering, Rammingetc.Lt ( Lift T 1 5 ) B Mehil Me 422 Excavationforfoundationinlateriterock ( Softorhard ) Includingtrimmingandlevellingthebedforthe Foundation, Removingtheexcavatedmaterialuptoadistanceof50metresbeyondthe Building Area, Stacking As Directed, Dewatering And Back Filling With Available Murum, Watering, Rammingetc.Complete. ( Lift Uto 1.5 M. ) By Mechanical Means 423 Providing Preconstructional Antitermite Treatment As Per I.S. 6313 ( Part-Ii ) By Treating Thebottom Surface And Sides Of Excavation At The Rate Of 5 Litres Of Emulsion Concentrate Of 1.0 Percentofchlorophyrifos Persquaremeterofsurfaceareacovering10yearsguaranteeon Bond Paper. 424 Providing Preconstructional Antitermite Treatment As Per I.S. 6313 ( Part-Ii ) Treatment Bytreatingthe Backfill In Immediate Contact With Foundation At The Rate Of 5 Litres Of Emulsion Concentrate Of 1.0 Percent Of Clorophyrifos Per Square Metre Of Vertical Surface Area Covering 10 Years Guarantee On Bond Paper. 425 Providingpreconstructionalantitermitetreatmentasperi.S.6313 ( Part-Ii ) Bytreatingthetopsurface Of Plinthfillingattherateof5litresofemulsionconcentrateat1.0Percentof Clorophyrifosper Squaremetre Of Surface Area Covering Ten Years Guarantee On Bond Paper. 426 Providing Preconstructional Antitermite Treatment As Per I.S. 6313 ( Part-I ) To The Soil Along The External Face Of Building By Punching Holes Of 1.2 Of 1.5 C.M. Diametre About 30 -60 Cm Deep At15cmc / Casclosetothe Wallaspossibleandtoinject0.5Percentof Aldrinor Clorophyrifosatthe Rate Of7.5Litresperhole Andsealing The Same Withproper Filling And Covering 10 Years Guarantee On Bond Paper. 427 Providingantitermitetreatmenttothewoodenframesofdoors / Windowsoftheexisting Building As Peri.S. 6313 ( Part-Iii ) By Drilling 6Mm Dia. Holes At Four Corners On One Side And Four Corners On Other Side At A Downwardangle Ofabout45degree Atthe Junctionofwoodworkandmasonaryandinjecting 150Ml.Of Chlorodane 5% W.C. And Sealing By Filling Putty Etc. Complete Covering 2 Years Guarantee On Bond Paper. 428 Providing Antitermite Treatment To The Joints Of Woodenbeams / Joist Usedfor The Roof Work Of Theexisting Buildingasperi.S.6313 ( Part-Iii ) Bydrilling6mm Dia.Holesatadownward Angle Of About 45 Degree At The Junction Of Wood Work And Masonary And Injecting 80 Ml. Of Chlorodane 5% W.C. And Sealing By Filling Putty Etc. Complete Covering 2 Years Guarantee On Bond Paper. 429 Providingantitermitetreatmenttothesidesofflooringoftheexistingbuildingasperi.S. 6313 ( Part- Iii ) By Punching Holes 6Mm Dia. Drilled At A Distance Of 30Cm. Centre To Centre And Injecting One Percentof Chlorodaneemulsion Concentrateattherateof 50Ml Perholeandsealingbyfillingputtyetc.Completecovering 2 Years Guarantee On Bond Paper. 430 Providing Antitermite Treatmentaroundthe Peripheryofthe Existing Building Asperi.S.6313 ( Part-Iii ) By Excavatingtrenchesof20cmwidthandexposingthesidesofcolumnsandplinthbeamsuptoadepthof 300Mm And Injecting One Percent Of Chlorodane Emulsion Concentrate At The Rate Of 2.25 Litres Per Running Metre And Refilling The Trenches Etc. Complete Covering 2 Years Guarantee On Bond Paper. 431 Providinggeneralpestcontrolservicestothebuilding Tocontrolthenuisance Ofcockroaches, Lizards, Pinbores And Other Insects Etc. With 4 Operations In A Year And Monthly Check Up. 432 Providinggeneralpestcontrolservicestosmallsizeofinspectionchambertocontrolthe Nuisance Ofcockroaches During The Year With Monthly Check Up. 433 Providinggeneralpestcontrolservicestobigsizeof Inspection Chamber Tocontrol The Nuisance Ofcockroaches During The Year With Monthly Check Up. 434 Labour Charges For Removing Grass, Thorney Shrubs, Jungli Shrub, Kubabul And Alike Grassalongroadside Making The Ground Clean By Showel And Phavaras Etc. Complete. 435 Removinggrass, Gazer Grassand Disposingoff Out Of Buildingpremisesincludingmaking Cleanthe Ground By Shovel And Phavaras Etc. Complete. 436 Fillinginplinthandfloorswith Approved Excavatedmaterialin15cm.To20cm.Layersincluding Watering And Compacting Etccomplete 437 Fillinginplinthandfloorswithcontractors Material / Broughtfromoutsideandapprovedbyengineer Incharge Inlayersof15cm To20cmincludingwateringandcompactionetc.Complete. 438 Providingdry / Trap / Granite / Quartzite / Gneissrubblestonesoling15cmto20cmthickincluding Hand Packing And Compacting Etc. Complete. 439 Providingandfillinginthefoundationwithsandofapprovedqualityincludingwatering, Compactingetccomplete ( To Be Executed With Prior Approval Of Superintending Engineer ) 440 Providing Soling Using80 Mm Sizetrap Metal In 15 Cm. Layer Includingfilling Voids Withcrushed Sand / Grit, Ramming, Watering Etc. Complete. 441 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 Rccsingle Rim Bored Pile Of 225 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatch Mix Plant ( Pan Mixer ) Etc. Complete. Withfine Aggregate ( Crushed Sandvsi Grade ) By Tremie Arrangement, Compaction Of Concrete Including Chipping And Dressing Including Chipping And Dressing If Required Etc. Complete. ( Excluding Steel Reinforcement ) 442 Providing And Layingcast In Situ / Ready Mix Cement Concrete Of M2o Grade Rcc Single Rim Bored Pile Of 300 Mm Dia. Each Of Load Capacity As Per Design And Of Specified Diameter Of Pile And Bulb As Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Of Reinforcement Including Placing With Fullyautomaticmicroprocessorbasedplcwithscadaenabledreversibledrumtypemixer / Concrete Batchmixplant ( Panmixer ) Etc.Complete.Withfineaggregate ( Crushedsandvsigrade ) By Tremie Arrangement Compactionofconcreteincludingchippinganddressingetc.Complete. ( Excludingsteelift ) 443 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 Forsingle Rim Bored Pile Of 380 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 444 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 For Single Rim Bored Pile Of 450 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 445 Providing And Laying M-20 Rcc Cast In Situ Single Rim Bored Pile Of 535 Mm Dia. Each Of Load Capacityas Perdesignandofspecifieddiameterofpileandbulbasdirected, Sunktothe Required Depth Through All Strata Except Rock, Excludingprovision Of Reinforcement Including Placingwithfullyautomaticmicro Processorbasedplcwithscadaenabledreversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushedsandvsigrade ) By Tremiearrangement Compaction Ofconcreteincluding Chipping And Dressing Etc. Complete. ( Excluding Steel Reinforcement ) 446 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 For Single Rim Bored Pile Of 600 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 447 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 For Single Rim Bored Pile Of 225 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 448 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 Forsingle Rim Bored Pile Of 300 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 449 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 Forsingle Rim Bored Pile Of 380 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 450 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 For Single Rim Bored Pile Of 450 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 451 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 For Double Rim Bored Pile Of 225 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 452 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 Fordouble Rim Bored Pile Of 300 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelreinfrcment ) 453 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 Fordouble Rim Bored Pile Of 380 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 454 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-20 For Double Rim Bored Pile Of 450 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangementcompaction Of Concrete Including Chipping And Dressing Etc. Complete. ( Excluding Steelift ) 455 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 Fordouble Rim Bored Pile Of 225 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatch Mix Plant ( Pan Mixer ) Etc. Complete. Withfine Aggregate ( Crushed Sandvsi Grade ) By Concretepreparedinreversibledrumtypeconcretemixerbytremiearrangement, Compactionofconcrete Including Chipping And Dressing Etc. Complete. ( Excluding Steel Reinforcement ) 456 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 Fordouble Rim Bored Pile Of 300 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatch Mix Plant ( Pan Mixer ) Etc. Complete. Withfine Aggregate ( Crushed Sandvsi Grade ) By Concretepreparedinreversibledrumtypeconcretemixerbytremiearrangement, Compactionofconcrete Including Chipping And Dressing Etc. Complete. ( Excluding Steel Reinforcement ) 457 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 For Double Rim Bored Pile Of 380 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatch Mix Plant ( Pan Mixer ) Etc. Complete. Withfine Aggregate ( Crushed Sandvsi Grade ) By Concretepreparedinreversibledrumtypeconcretemixerbytremiearrangement, Compactionofconcrete Including Chipping And Dressing Etc. Complete. ( Excluding Steel Reinforcement ) 458 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 For Double Rim Bored Pile Of 450 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatch Mix Plant ( Pan Mixer ) Etc. Complete. Withfine Aggregate ( Crushed Sandvsi Grade ) By Concretepreparedinreversibledrumtypeconcretemixerbytremiearrangement, Compactionofconcrete Includingchippingand Dressing Etc. Complete. Concrete Prepared In Reversible Drum Type Concrete Mixer Bytremiearrangement, Compactionofconcreteincludingchippinganddressingetc.Complete. ( Excluding Steel Reinforcement ) 459 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 For Double Rim Bored Pile Of 535 Mm Dia. Eachof Loadcapacity As Per Designandof Specified Diameter Of Pile And Bulbas Directed, Sunk To The Required Depth Through All Strata Except Rock, Excluding Provision Ofreinforcementincludingplacingwith Fully Automatic Micro Processor Based Plc Withscada Enabled Reversible Drum Type Mixer / Concretebatch Mix Plant ( Pan Mixer ) Etc. Complete. Withfine Aggregate ( Crushed Sandvsi Grade ) By Concretepreparedinreversibledrumtypeconcretemixerbytremiearrangement, Compactionofconcrete Including Chipping And Dressing Etc. Complete. ( Excluding Steel Reinforcement ) 460 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-25 For In Situ Double Rim Bored Pile Of 600 Mm Dia. Each Of Load Capacity As Per Design And Of Specified Diameter Of Pile Andbulbasdirected, Sunkto Therequireddepththroughallstrataexceptrock, Excluding Provision Of Reinforcement Including Placing With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batchmixplant ( Panmixer ) Etc.Complete.Withfineaggregate ( Crushedsandvsigrade ) Byconcrete Preparedinreversible Drum Type Concrete Mixerbytremie Arrangement, Compactionof Concrete Including Chippinganddressingetc.Complete.Concretepreparedinreversibledrumtypeconcretemixerbytremie Arrangement, Compaction Ofconcreteincludingchippingand Dressingetc.Complete. ( Excluding Steel Reinforcement ) 461 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 For Bored Piles Each Of Load Capacity And As Per Design And Of 325 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushedsandvsigrade ) By Concretepreparedbytremie Arrangement, Compactionofconcreteincludingchippinganddressingetc.Complete.Concretebytremie Arrangements, Compaction Of Concrete Including Chipping And Dressing And Withdrawal Ofshelletc. Complete. ( Excluding Steel Reinforcement ) 462 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 350Mm Diameter Or As Directed Placed Throughsteel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushedsandvsi Grade ) By Tremiearrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 463 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 400 Mm Diameter.Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) Bytremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 464 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 425Mm Diameter Or As Directed Placed Throughsteel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) Bytremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 465 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 475Mm Diameter Or As Directed Placed Throughsteel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 466 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 500Mm Diameter Or As Directed Placed Throughsteel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) Bytremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 467 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 525 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) Bytremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 468 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 550 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) Bytremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 469 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 600 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved Bytheengineer-In-Charge Includingplacingwithfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) Bytremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 470 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 625 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 471 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 650 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 472 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 750 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 473 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 800 Mm Diameter. Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 474 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 825 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 475 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 900 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 476 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 975 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 477 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 1000 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 478 Providing And Layingcast In Situ / Ready Mix Cement Concrete M-30 Forbored Piles Each Of Load Capacity And As Per Design And Of 1050 Mm Diameter Or As Directed Placed Through Steel Shellssunktotherequired Depththroughallstrataexceptrockexcludingprovisionof Reinforcementasperdetaileddrawingsand Design Approved By The Engineer-In- Chargeincludingplacing With Fully Automatic Micro Processor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) By Tremie Arrangements, Compaction Of Concreteincluding Chipping And Dressing And Withdrawal Of Shell Etc. Complete. ( Excluding Steel Reinforcement ) 479 Chiselingthroughpileshellsinhardstratalikeboulders, Softandhardrocksuptoand Inclusiveof550mmdiameterincludingremovingandstackingtheloosematerialsetc. Complete And Disposing Of The Unserviceable Materials Outside Complete. 480 Chiseling Through Pile Shells In Hard Strata Like Boulders, Soft And Hard Rocks Beyond 550 Mm And Upto And Inclusive Of750 Mm Dia. Including Removing And Stacking The Loose Materials Etc. Complete And Disposing Ofthe Unserviceable Materials Outside Complete. 481 Chiseling Through Pile Shells In Hard Strata Like Boulders, Soft And Hard Rocks Beyond 750 Mm And Upto And Inclusive Of900 Mm Dia Including Removing And Stacking The Loose Materials Etc. Complete And Disposing Ofthe Unserviceable Materials Outside Complete. 482 Chiseling Through Pile Shells In Hard Strata Like Boulders, Soft And Hard Rocks Beyond 900 Mm And Upto And Inclusive Of1050 Mm Dia. Including Removing And Stacking The Loose Materials Etc. Complete And Disposing Ofthe Unserviceable Materials Outside Complete. 483 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Upto400mmdiameterincludingconstructionoftestcap, Useofaccessoriesand Instruments Including Providing Graphs As Per I.S. Code Or Std.Specifications And Dismantling The Test Cap After Testing And Cleaningthe Site Complete 484 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Above 400 Mm And Upto To 550Mm Diameter Including Constructionof Test Cap, Use Of Accessoriesand Instrumentsincluding Providing Graphsasperi.S. Code Or Std.Specifications And Dismantling Thet Tftt Ti D Li Thitlt 485 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Above550mmandupto650mmdiameterincludingconstructionoftestcap, Useofaccessoriesand Instruments Including Providing Graphs As Per I.S. Code Or Std.Specifications And Dismantling The Test Cap Aftertesting And Cleaning The Site Complete. 486 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Above650mmandupto750mmdiameterincludingconstructionoftestcap, Useofaccessoriesand Instruments Including Providing Graphs As Per I.S. Code Or Std.Specifications And Dismantling The Test Cap Aftertesting And Cleaning The Site Complete. 487 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Above750mmandupto825mmdiameterincludingconstructionoftestcap, Useofaccessoriesand Instruments Including Providing Graphs As Per I.S. Code Or Std.Specifications And Dismantling The Test Cap Aftertesting And Cleaning The Site Complete. 488 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Above825mmandupto900mmdiameterincludingconstructionoftestcap, Useofaccessoriesand Instruments Including Providing Graphs As Per I.S. Code Or Std.Specifications And Dismantling The Test Cap Aftertesting And Cleaning The Site Complete. 489 Carryingoutloadtestfor1.5Timestheproposedsafeworkingloadonthepileindriven Position Above 900Mm Diameterincluding Constructionoftestcap, Use Of Accessoriesand Instruments Including Providing Graphs As Per I.S. Code Or Std.Specifications And Dismantling The Test Cap After Testing And Cleaningthe Site Complete 490 Empty Boring For 325 To 400 Mm Dia Bored R.C.C. Cast In Situ Piles Including Withdrawal Of Shell, Removal Of Earth To A Distance Of 50 Metres Etc. Complete.Spec : ( As Directed By Engineer In Charge ) 491 Empty Boring For 425 To 500 Mm Dia. Bored R.C.C. Cast In Situ Piles Including Withdrawal Of Shell, Removal Of Earth To A Distance Of 50 Metres Etc. Complete.Spec : ( As Directed By Engineer In Charge ) 492 Empty Boring For 525 To 600 Mm Dia. Bored R.C.C. Cast In Situ Piles Including Withdrawal Of Shell, Removal Of Earth To A Distance Of 50 Metres Etc. Complete.Spec : ( As Directed By Engineer In Charge ) 493 Empty Boring For 625 To 700 Mm Dia. Bored R.C.C. Cast In Situ Piles Including Withdrawal Of Shell, Removal Of Earth To A Distance Of 50 Metres Etc. Complete.Spec : ( As Directed By Engineer In Charge ) 494 Empty Boring For 725 To 1050 Mm Dia. Bored R.C.C. Cast In Situ Piles Including Withdrawal Of Shell, Removal Of Earth To A Distance Of 50 Metres Etc. Complete.Spec : ( As Directed By Engineer In Charge ) 495 Chipping And Dressing Of The R.C.C. Piles Upto 0.60Meterincluding Cleaning Reinforcement And Removal Of Dismantled Materials Upto A Distance Of 50 Meter Beyond The Building Area Etc. For Providing Pile Caps.Spec : ( As Directed By Engineer In Charge 496 Providing Bentonite Slurry Process For Various Diameter Of Piles Vide Item Nos 1 ( I To Xxiv ) Above. Spec : ( As Directed By Engineer In Charge ) 497 Providing Placing And Driving In Position 6 Millimeter Mild Steel Liner For R.C.C. Piles Upto Required Depth With 12Mm Thick Mild Steel Cutting Edge Of 0.50M Length At Bottom Including Fabricating Cutting The Mild Steel Sheet To Required Diameter And Shape , Welding The Joints And Drivingwiththehelpofrequiredmachineries Includingallmaterialslaboursandliftsetc. Complete As Directed By The Engineer In Charge.Upto 3.00 Meter Deep Liner 498 Providing Placing And Driving In Position 6 Millimeter Mild Steel Liner For R.C.C. Piles Upto Required Depth With 12Mm Thick Mild Steel Cutting Edge Of 0.50M Length At Bottom Including Fabricating Cutting The Mild Steel Sheet To Required Diameter And Shape , Welding The Joints And Drivingwiththehelpofrequiredmachineries Includingallmaterialslaboursandliftsetc. Complete As Directed By The Engineer In Charge.Spec : ( As Directed By Engineer In Charge From 3.00 To 9.50 Meter Deep Liner 499 Providing And Laying Cast In Situ / Ready Mix Cement Concrete M-20 Of Trap Metal For R.C.C. Pilecapsasper Detailed Designs And Drawings, Including Bailing Out Water Manually, Centering, Formwork, Laying / Pumping, Compacting, Finishingandcuringetc.Withfully Automaticmicro Processorbasedplcwith Scadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Panmixer ) Etc.Complete.With Crushedsandvsigrade / V.S.I. Quality Artificial Sand, Complete. ( Excluding Steel Reinforcement ) 500 Providing And Laying Cast In Situ / Ready Mix Cement Concrete M-25 Of Trap Metal For R.C.C. Pilecapsasper Detailed Designs And Drawings, Including Bailing Out Water Manually, Centering, Formwork, Laying / Pumping, Compacting, Finishingandcuringetc.Withfully Automaticmicro Processorbasedplcwith Scadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Panmixer ) Etc.Complete.With Crushedsandvsigrade / V.S.I. Quality Artificial Sand, Complete. ( Excluding Steel Reinforcement ) 501 Providing And Laying Cast In Situ / Ready Mix Cement Concrete M-30 Of Trap Metal For R.C.C. Pilecapsasper Detailed Designs And Drawings, Including Bailing Out Water Manually, Centering, Formwork, Laying / Pumping, Compacting, Finishingandcuringetc.Withfully Automaticmicro Processorbasedplcwith Scadaenabledreversibledrum Typemixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) Complete. ( Excluding Steel Reinforcement ) 502 Providing And Fabricating Structural Steel Work In Rolled Sections Like Joists, Channels, Angles, Teesetc.Asper Detaileddesignanddrawingsorasdirectedincludingcutting, Fabricating, Hoisting, Erecting, Fixingin Positionmakingriveted / Bolted / Weldedconnectionswithout Connecting Plates, Braces Etc. Andincluding Onecoatofanticorrosivepaintand Overit Twocoatsofoilpaintingofapprovedqualityandshadeetc.Lt 503 Providing And Fabricating Structural Steel Work In Rolled Sections, Fixed With Connecting Plates Oranglecleats Inmainandcrossbeams, Hipandjackrafters, Purlinsconnectingtotruss Members Andthe Like, As Per Detailed Designs And Drawing Or As Directed Including Cutting, Fabricating, Hoisting, Erecting, Fixing In Position, Making Riveted / Bolted / Welded Connections And One Coat Of Anticorrosive Paint And Over It Two Coats Of Oil Paintingofapproved Quality And Shade Etc. Complete. 504 Providingstructuralsteelworkinsinglestanchionscomposedofr.S.J.Channeletc.With Caps, Bases, Mild Steel Plated, Angle Brackets, Cleats, Gusset Plates, Anchor Bolts Etc. As Perdetaileddesignsand Drawings Or As Directedincluding Cutting, Fabrication, Hoisting, Erecting Fixing In Position, Making Riveted / Bolted / Weldedconnectionandone Coat Of Anticorrosive Paint And Over It Two. Coats Of Oil Painting Approvedquality And Shade Etccomplete 505 Providing Structural Steel Work In Trusses, Other Similar Trussed Purlins And Members With All Bracing, Gusset Platesetc.Asperdetaileddesignsanddrawingsorasdirectedincluding Cutting, Fabricating, Hoisting, Erecting Fixing In Position, Making Riveted / Bolted / Weldedconnection And Onecoatofanticorrosive Paint Andover It 2 Coats Of Oil Painting Approved Quality And Shade Etc. Complete. 506 Providing And Fixing 50 Mm. Dia. Medium Class G.I.Pipe Gate With Wicket Gate Of Approved Drawing Withall Fixturesandfittingsintwoleaveswithstrong Holdfastembeddedinc.C. Block At Top And Bottom With Locking Arrangement Including Cutting, Bending, Making Holes And With One Coat Of Primer Etc. Complete. 507 Providing And Erectingstructural Steel For Sakav With All Bracinggusset Platesetc. Asperdetailed Designanddrawing Or As Directed Including Cutting, Fabricating, Hoisting, Erecting, Fixing In Position, Making Riveted / Bolted / Welded Connection And Oil Painting With 2 Coats Of Approved Quality And Shade Etc. Complete.Complete. 508 Providing, Fabricatingand Erecting At Siteof Workthetubular Steel Structure ( Shed ) Asper Standard Design And Specifications Having Various Spans In Between Trusses And In Multiples Of Standard Length Of Bays As Specified As Per Standard Specifications, Inclusive Of Cost Of Steel Tubular Trusses, Tubular Columns Purlins, Tie Runners, Foundationbolts, Base Plates, Nuts And Bolts, Weldingwhereverrequiredetc. Asperdetailed Drawinginclusiveofonecoatof Anticorrosive Paint And Two Coats Of Oil Painting Of Approved Quality And Shade Etc. Complete. Spec. Number : As Directed By Engineer-In-Charge. 509 Providing Gas Or Electrical Welding For Structural Steel Section, Plates As Per Detailed Drawing.For Less Than 10 Mm Thick Section. 510 Providing And Fixing Mild Steel Grill Gate As Per The Detailed Drawing Including Hinges, Locking Arrangements And Painting In Three Coats Of Oil Paint Of Approved Colour And Shade Etc.Complete. ( Weight18 Kilogram. To 20 Kilogram. Per Sq.M. ) Spec Numberas Directed By Engineer- In-Charge 511 Providing Structural Steel Work Of Rectangular Hollow Steel Section For Steel Trusses, Othersimilar Trusseditemslikepurlinandmemberswithallbracing, Gussetplatesetc.Asper Detailed Designs And Drawingsorasdirectedincludingcutting, Fabricating, Hoisting, Erecting, Fixinginpositionmaking Riveted / Bolted / Welded Connections And One Coat Of Anticorrosivepaintandoverittwocoatsofoil Painting Of Approved Quality And Shade Complete. 512 Providingstructuralsteelworkinhollowsectionofvariousthicknessandsizesinsquare, Rectanular And Round Shape From 25Mm To 450Mmsection As Per Is 4923 Yst 310 Grade Produced From Iron Ore And Blast Furnace Route Etc. As Per Detailed Designs And Drawing Or As Directed Including Cutting, Fabricating, Hoisting, Erecting, Fixing In Position, Making Riveted / Bolted / Welded Connections And Paintingcomplete. 513 Providing And Laying Cast In Situ / Ready Mix Cement Concrete In M-10 Of Trap / Granite / Quartzite / Gneiss Metal For Foundation And Bedding Including Bailing Out Water, Steelcentering, Formwork, Laying / Pumping, Compacting, Roughening Them If Special Finish Is To Be Provided, Finishingifrequiredand Curingcomplete, Withfullyautomaticmicroprocessor Based Plc With Scada Enabled Reversible Drum Typemixer / Concretebatchmixplant ( Panmixer ) Etc.Complete. Withfineaggregate ( Crushedsandvsig D ) 514 Providing And Laying Cast In Situ / Ready Mixcement Concrete In M15 Of Trap / Granite / Quartzite / Gneissmetalforstepsincludingsteelcentering, Formwork, Laying / Pumping, Compacting, Roughening Themif Special Finish Is Tobeprovided, Finishing Uneven Andhoneycombedsurface And Curing Etc. Complete. The Cement Mortar 1:3Plaster Is Consideredfor Rendering Uneven Andhoneycombed Surface, Only.Newlylaidconcreteshallbecoveredby Gunny Bag, Plastic, Tarpaulin Etc. ( Wooden Centering Will Not Be Allowed. ) , With Fullyautomaticmicroprocessorbasedplcwithscada Enabled Reversible Drum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc.Complete.Withfine Aggregate ( Crushed Sand Vsi Grade ) 515 Providingandlayingcastinsitu / Readymixcementconcreteinm20oftrap / Granite / Quartzite / Gneissmetalforstepsincludingsteelcentering, Formwork, Laying / Pumping, Compacting, Roughening Themif Special Finish Is Tobeprovided, Finishing Uneven Andhoneycombedsurface And Curing Etc. Complete. The Cement Mortar 1:3Plaster Is Consideredfor Rendering Uneven Andhoneycombed Surface, Only.Newlylaidconcreteshallbecoveredby Gunny Bag, Plastic, Tarpaulin Etc. ( Wooden Centeringwillnotbeallowed. ) , Withfully Automaticmicro Processorbasedplcwithscadaenabled Reversible Drumtype Mixer / Concretebatchmixplant ( Panmixer ) Etc.Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) 516 Providing And Laying Cast In Situ / Ready Mix Cementconcrete In M15 Of Trap / Granite / Quartzite / Gneissmetalforbedblocks, Foundationblocksand Suchotheritems Includingbailing Outwater, Steelcentering, Formwork, Laying / Pumping, Compacting, Rougheningthemifspecialfinish Is To Be Provided, Finishing Uneven And Honeycombedsurfaceandcuringetc.Complete.Thecement Mortar 1:3Plaster Is Consideredfor Rendering Unevenandhoneycombedsurface Only. Newly Laidconcrete Shallbe Coveredbygunnybag, Plastic, Tarpaulin Etc. ( Wooden Centering Will Not Beallowed. ) , With Fullyautomatic Micro Processor Basedplcwithscada Enabledreversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 517 Providing And Laying Cast In Situ / Ready Mix Cementconcrete In M20 Of Trap / Granite / Quartzite / Gneissmetalforbedblocks, Foundationblocksand Suchotheritems Includingbailing Outwater, Steelcentering, Formwork, Laying / Pumping, Compacting, Rougheningthemifspecialfinish Is To Be Provided, Finishing Uneven And Honeycombedsurfaceandcuringetc.Complete.Thecement Mortar 1:3Plaster Is Consideredfor Rendering Unevenandhoneycombedsurface Only. Newly Laidconcrete Shallbe Coveredbygunnybag, Plastic, Tarpaulin Etc. ( Wooden Centering Will Not Beallowed. ) , With Fully Automatic Microprocessorbasedplcwithscadaenabledreversible Drumtype Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 518 Providingandlayingcastinsitu / Readymixcementconcreteinm-20Oftrap / Granite / Quartzite / Gneissmetal For Arches Includingskew Backs Asper Detailed Drawingor Asdirected In Superstructure Including Steel Centering, Formwork, Compacting, Finishing Withminimum Thicknessof1:3 Cement Plaster To Give A Smooth And Even Surface Or Roughening Them Ifspecial Finish Is To Be Provided Andcuringandfinishingifrequiredcomplete, Withfully Automaticmicroprocessorbased Plcwithscadaenabledreversibledrum Typemixer. Complete, . With Fine Aggregate ( Crushed Sandvsi G D ) 519 Providing And Laying Cast In Situ / Ready Mix Cementconcrete In M15 Of Trap / Granite / Quartzite / Gneissmetalforplainormoldedsills, Cornice, Jambs, Blockincourse, Or Architraves Of Required Size And Shapes Including Steel Centering, Formwork, Laying / Pumping, Compacting, Roughening Them If Special Finish Is To Be Provided, Finishing Uneven Andhoneycombedsurfaceandcuringetc. Complete. The Cement Mortar 1:3 Plaster Is Considered For Rendering Uneven And Honeycombed Surface Only. Newly Laid Concrete Shall Be Covered By Gunnybag, Plastic, Tarpaulinetc. ( Woodencenteringwillnotbe Allowed. ) With Fullyautomatic Microprocessor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batchmixplant ( Panmixer ) Etc.Complete.Withfine Aggregate ( Crushedsandvsig D ) 520 Providing And Laying Cast In Situ / Ready Mix Cementconcrete In M20 Of Trap / Granite / Quartzite / Gneissmetalforplainormoldedsills, Cornice, Jambs, Blockincourse, Or Architraves Of Required Size And Shapes Including Steel Centering, Formwork, Laying / Pumping, Compacting, Roughening Them If Special Finish Is To Be Provided, Finishing Uneven Andhoneycombedsurfaceandcuringetc. Complete. The Cement Mortar 1:3 Plaster Is Considered For Rendering Uneven And Honeycombed Surface Only. Newly Laid Concrete Shall Be Covered By Gunnybag, Plastic, Tarpaulinetc. ( Woodencenteringwillnotbe Allowed. ) With Fullyautomatic Micro Processor Based Plc With Scada Enabled Reversible Drum Typemixer Etc. Complete, With Fine Aggregate ( Crushed Sand Vsi Grade ) 521 Providing Andlaying Castin Situ / Readymix Cement Concrete M-15Oftrap / Granite / Quartzite / Gneissmetalforcoping To Plinthorparapet, Mouldedorchamferedasper Drawingor Asdirectedincludingsteelcentering, Plywood / Steelformworkcompacting, Rougheningthemifspecial Finish Is To Be Provided, Finishing Uneven And Honeycombedsurfaceandcuringetc.Complete.The Cementmortar1:3Plasterisconsideredforrenderingunevenandhoneycombedsurfaceonly.Newlylaid Concrete Shall Be Covered By Gunny Bag, Plastic, Tarpaulin Etc. ( Wooden Centering Will Not Be Allowed. ) With Fine Aggregate ( Crushed Sand Vsi Grade ) 522 Providing And Laying In Situ / Ready Mixcement Concretem-20Of Trap / Granite / Quartzite / Gneiss Metalforr.C.C.Work Infoundationslikeraft, Stripfoundations, Grillageand Footingsofr.C.C.Columnsand Steel Stanchionsetc. Including Bailing Out Water, Steelcentering Formwork, Laying / Pumping Cover Blocks, Compaction And Curingrougheningthesurfaceifspecialfinishistobeprovided ( Excluding Reinforcementandstructuralsteel ) Etc.Complete, Withfullyautomaticmicroprocessorbasedplcwith Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 523 Providingandlayingcastinsitu / Readymixcementconcretem-25Oftrap / Granite / Quartzite / Gneissmetalforr.C.C.Workinfoundationslike Raft, Strip Foundations, Grillage And Footings Of R.C.C. Columns And Steel Stanchions Etc. Including Bailing Out Water, Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compaction And Curing Roughening The Surface If Special Finish Is To Be Provided ( Excluding Reinforcement And Structural Steel ) Etc. Complete, With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 524 Providingandlayingcastinsitu / Readymixcementconcretem-30Oftrap / Granite / Quartzite / Gneissmetalforr.C.C.Workinfoundationslike Raft, Strip Foundations, Grillage And Footings Ofr.C.C.Columnsandsteelstanchionsetc.Columnsasperdetaileddesignsanddrawingorasdirected Includingsteel Centering Formwork, Coverblocks Laying / Pumping, Compaction Finishing The Formed Surfaceswithcementmortar1:3Ofsufficientminimum Thickness To Give A Smooth And Even Surface Or Rougheningifspecialfinishistobeprovidedandcuringetc.Complete. ( Excludingreinforcementand Structural Steel ) . With Fully Automatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concrete Batchmixplant ( Panmixer ) Etc. Complete. Withfine Aggregate ( Crushedsandvsi G D ) 525 Providingandlayingcastinsitu / Readymixcementconcretem-35Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Workin Foundations Like Raft, Strip Foundations, Grillage Andfootings Ofr.C.C.Columnsandsteelstanchions Etc.Columnsasperdetaileddesignsanddrawing Or As Directed Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing Theformed Surfaceswithcementmortar1:3Ofsufficientminimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .Withfullyautomaticmicro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 526 Providingandlayingcastinsitu / Readymixcementconcretem-40Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Workin Foundations Like Raft, Strip Foundations, Grillage Andfootings Ofr.C.C.Columnsandsteelstanchions Etc.Columnsasperdetaileddesignsanddrawing Or As Directed Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing The Formed Surfaceswithcementmortar1:3Ofsufficientminimum Thickness To Give A Smooth And Even Surface Or Rougheningifspecialfinishistobeprovidedandcuringetc.Complete. ( Excludingreinforcementand Structural Steel ) .With Fully Automatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concrete Batchmixplant ( Panmixer ) Etc. Complete. Withfine Aggregate ( Crushedsandvsi G D ) 527 Providingandlayingcastinsitu / Readymixcementconcretem-20Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Columns As Per Detailed Designs And Drawing Or As Directed Including Steel Centering, Formwork, Coverblocks, Laying / Pumping, Compactionfinishing The Formedsurfaceswithcement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete. ( Excluding Reinforcement And Structural Steel ) .With Fullyautomaticmicroprocessorbasedplcwithscadaenabledreversibledrumtypemixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 528 Providingandlayingcastinsitu / Readymixcementconcretem-25Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Columns As Per Detailed Designs And Drawings Or Asdirected Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compactionfinishingtheformed Surfaceswithcementmortar1:3Ofsufficientminimumthicknesstogiveasmooth Andevensurfaceor Rougheningifspecialfinishistobeprovided Andcuringetc.Complete, ( Excludingreinforcementand Structural Steel ) .With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 529 Providingandlayingcastinsitu / Readymixcementconcretem-30Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Columns As Per Detailed Designs And Drawing Or As Directed Including Steel Centering, Formwork, Coverblocks, Laying / Pumping, Compactionfinishingtheformedsurfaceswithcement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) . With Fullyautomaticmicroprocessorbasedplcwithscadaenabledreversibledrumtypemixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 530 Providingandlayingcastinsitu / Readymixcementconcretem-35Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Columns As Per Detailed Designs And Drawing Or As Directed Including Steel Centering, Formwork, Coverblocks, Laying / Pumping, Compactionfinishing The Formedsurfaceswithcement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .With Fully Automatic Micro Processor Based Plc Without Scad Aenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 531 Providingandlayingcastinsitu / Readymixcementconcretem-40Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Columns As Per Detailed Designs And Drawing Or As Directed Including Steel Centering, Formwork, Coverblocks, Laying / Pumping, Compactionfinishing The Formedsurfaceswithcement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .With Fullyautomaticmicroprocessorbasedplcwithscadaenabledreversibledrumtypemixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 532 Providingandlayingcastinsitu / Readymixcementconcretem-20Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Beams And Lintels As Per Detailed Designs And Drawings Or As Directed Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compactionand Roughening Thesurfaceifspecialfinishistobeprovided And Curingetc. Complete. ( Excluding Reinforcement And Structural Steel ) . With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushedsandvsi G D ) 533 Providing And Laying Cast In Situ / Ready Mix Cement Concrete In M-25 Of Trap / Granite / Quartzite / Gneiss Metal For R.C.C. Beams And Lintels As Per Detailed Designs And Drawings Or As Directed Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compactionand Roughening The Surface If Special Finish Is Tobeprovidedandcuringetc.Complete. ( Excludingreinforcement And Structural Steel ) .With Fully Automatic Microprocessor Based Plc Withscada Enabled Reversibledrumtypemixer / Concrete Batchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 534 Providingandlayingcastinsitu / Readymixcementconcretem-30Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Beams And Lintels As Per Detailed Designs And Drawings Or As Directed Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compactionand Roughening Thesurfaceifspecialfinishistobeprovidedandcuringetc. Complete. ( Excluding Reinforcement And Structural Steel ) .With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 535 Providing And Laying Cast In Situ / Ready Mixcement Concrete M-35 Of Trap / Granite / Quartzite / Gneiss Metal Forr.C.C.Beamsandlintelsasperdetaileddesignsanddrawingsorasdirectedincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compactionand Roughening The Surface If Special Finish Is To Be Providedandcuringetc.Complete. ( Excludingreinforcement And Structural Steel ) .With Fully Automatic Microprocessorbasedplcwith Scadaenabledreversibledrumtypemixer / Concretebatchmix Plant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 536 Providingandlayingcastinsitu / Readymixcementconcretem-40Oftrap / Granite / Quartzite / Gneiss Metal For R.C.C. Beams And Lintels As Per Detailed Designs And Drawings Or As Directed Including Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compactionand Roughening Thesurfaceifspecialfinishistobeprovided And Curingetc. Complete. ( Excluding Reinforcement And Structural Steel ) . With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushedsand Vsi G D ) 537 Providingandlayingcastinsitu / Readymixcementconcretem-20Oftrap / Granite / Quartzite / Gneiss Metalforr.C.C. Slabsand Landings As Perdetailed Designsand Drawingsincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing The Formed Surfaces With Cement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .With Fully Automatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 538 Providingandlayingcastinsitu / Readymixcementconcretem-25Oftrap / Granite / Quartzite / Gneiss Metalforr.C.C. Slabsand Landings As Perdetailed Designsand Drawingsincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing The Formed Surfaces With Cement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .With Fully Automatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 539 Providingandlayingcastinsitu / Readymixcementconcretem-30Oftrap / Granite / Quartzite / Gneiss Metalforr.C.C. Slabsand Landings As Perdetailed Designsand Drawingsincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing The Formed Surfaces With Cement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .With Fully Automatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 540 Providingandlayingcastinsitu / Readymixcementconcretem-35Oftrap / Granite / Quartzite / Gneiss Metalforr.C.C. Slabsand Landings As Perdetailed Designsand Drawingsincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing The Formed Surfaces With Cement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Beprovidedandcuringetc.Complete, ( Excludingreinforcementandstructuralsteel ) .Withfully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mixplant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 541 Providingandlayingcastinsitu / Readymixcementconcretem-40Oftrap / Granite / Quartzite / Gneiss Metalforr.C.C. Slabsand Landings As Perdetailed Designsand Drawingsincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compaction Finishing The Formed Surfaces With Cement Mortar 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening If Special Finish Is To Be Provided And Curing Etc. Complete, ( Excluding Reinforcement And Structural Steel ) .With Fully Automatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 542 Providing And Laying Cast In Situ / Ready Mixcement Concrete M-20 Of Trap / Granite / Quartzite / Gneiss Metal Forr.C.C.Chajjaasperdetaileddesignanddrawingsincludingsteelcentering, Formwork, Coverblocks, Laying / Pumping, Compactingand Rougheningthesurfaceif Specialfinishistobeprovidedandcuring Complete. ( Excluding Reinforcement And Structural Steel ) . Withfullyautomaticmicroprocessorbasedplc With Scadaenabled Reversible Drumtype Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) 543 Providing And Laying Cast In Situ / Ready Mixcement Concrete M-25 Of Trap / Granite / Quartzite / Gneiss Metal Forr.C.C.Chajjaasperdetaileddesignanddrawingsincludingsteelcentering, Formwork, Coverblocks, Laying / Pumping, Compactingand Rougheningthesurfaceif Specialfinishistobeprovidedandcuring Complete. ( Excluding Reinforcement And Structural Steel ) . Withfullyautomaticmicroprocessorbasedplc With Scadaenabled Reversible Drumtype Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) 544 Providingand Layingcast In Situ / Ready Mix Cement Concretem-20 Of Trap / Granite / Quartzite / Gneiss Metal For R.C.C. Canopy As Per Detailed Designs And Drawings Includingsteelcentering, Formwork, Laying / Pumping, Compacting And Roughening The Surface If Special Finishistobeprovidedand Curing Etc. Complete ( Excluding Reinforcement ) , With Fullyautomaticmicroprocessorbasedplcwith Scadaenabledreversible Drum Type Mixer / Concrete Batchmix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 545 Providingand Layingcast In Situ / Ready Mix Cement Concretem-25 Of Trap / Granite / Quartzite / Gneiss Metal For R.C.C. Canopy As Per Detailed Designs And Drawings Includingsteelcentering, Formwork, Laying / Pumping, Compacting And Roughening The Surface If Special Finishistobeprovidedand Curing Etc. Complete ( Excluding Reinforcement ) . With Fullyautomaticmicroprocessorbasedplcwith Scadaenabledreversible Drum Type Mixer / Concrete Batchmix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 546 Providing And Laying Cast In Situ / Ready Mix Cement Concrete In M-20 Of Trap / Granite / Quartzite / Gneissmetalforr.C.C.Pardiofrequiredthicknessincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compacting , Curing , Finishing And Rougheningthem Ifspecial Finishistobeprovided Andcuringcomplete. ( Excludingreinforcementand Structuralsteel ) .Withfullyautomaticmicroprocessor Basedplcwithscadaenabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 547 Providing And Laying Cast In Situ / Ready Mix Cement Concrete In M-25 Of Trap / Granite / Quartzite / Gneissmetalforr.C.C.Pardiofrequiredthicknessincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compacting And Roughening Them If Special Finish Istobeprovidedandcuringcomplete. ( Excluding Reinforcement And Structural Steel ) .Withfullyautomatic Microprocessor Based Plc With Scada Enabled Reversibledrumtype Mixer / Concretebatchmix Plant ( Panmixer ) Etc.Complete. Withfineaggregate ( Crushed Sand Vsi Grade ) 548 Providing And Laying Cast In Situ / Ready Mix Cement Concrete In M-20 Of Trap / Granite / Quartzite / Gneissmetalforr.C.C.Coping Toplinthorparapetandsill Ofdoors Andwindows Mouldedas Perdetailed Drawingsorchamferedasapprovedbytheengineerincludingsteelcentering, Formwork, Cover Blocks, Laying / Pumping, Compacting , Curing , Finishing Androughening Them If Special Finish Is To Be Provided And Curing Complete. ( Excludingreinforcement And Structural Steel ) .With Fully Automatic Microprocessorbasedplcwith Scadaenabledreversibledrumtypemixer / Concretebatchmix Plant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 549 Providingandlayingcastinsitu / Readymixcementconcretein M-20Oftrap / Quartzite / Granite / Gneiss Metal For R.C.C. Waist Slab, And Steps Of Staircases As Per Detailed Design And Drawingsoras Directedincludingsteelcentering, Formwork, Steelprops, Laying / Pumping, Compaction, Finishing Uneven And Honeycombed Surface With C.M. 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Rougheningthesurfaceif Specialfinish Istobeprovided And Curingetc.Complete. ( Excluding Einforcement, Including Cover Block ) . ( Newly Laid Concrete Shall Be Covered By Gunny Bag, Plastic, Tarpaulin Etc. ) Withfullyautomaticmicroprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 550 Providingandlayingcastinsitu / Readymixcementconcretein M-25Oftrap / Quartzite / Granite / Gneiss Metal For R.C.C. Waist Slab, And Steps Of Staircases As Per Detailed Design And Drawingsoras Directedincludingsteelcentering, Plywood / Steelformwork, Steelprops, Laying / Pumping, Compaction, Finishinguneven And Honeycombed Surfacewith C.M. 1:3 Ofsufficientminimumthicknesstogivea Smooth And Even Surface Or Roughening The Surface If Special Finish Is To Be Provided And Curing Etc. Complete. ( Excluding Einforcement, Including Cover Block ) . ( Newly Laid Concrete Shall Be Covered By Gunny Bag, Plastic, Tarpaulin Etc. ) With Fullyautomaticmicroprocessorbasedplcwithscadaenabledreversibledrum Type Mixer / Concretebatchmixplant ( Panmixer ) Etc.Complete.Withfineaggregate ( Crushed Sand Vsi Grade ) 551 Providingandlayingcastinsitu / Readymixcementconcretein M-20Oftrap / Quartzite / Granite / Gneiss Metal For R.C.C.Newel Posts Of Staircase As Per Detailed Design And Drawings Including Steel Centering, Plywood / Steel Formwork, Steel Props, Laying / Pumping, Compaction, Finishing Uneven And Honeycombed Surface With C.M.1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening The Surface If Special Finish Is To Be Provided And Curing Etc. Complete. ( Excluding Reinforcement, Including Cover Block ) . ( Newlylaid Concreteshall Becovered By Gunny Bag, Plastic, Tarpaulin Etc. ) Withfullyautomatic Microprocessorbasedplcwithscadaenabledreversibledrumtypemixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 552 Providingandlayingcastinsitu / Readymixcementconcretein M-25Oftrap / Quartzite / Granite / Gneiss Metal For R.C.C.Newel Posts Of Staircase As Per Detailed Design And Drawings Including Steel Centering, Plywood / Steelformwork, Steelprops, Laying / Pumping, Compaction, Finishingunevenand Honeycombedsurface Withc.M.1:3Of Sufficient Minimum Thickness To Give Asmoothandevensurface Or Rougheningthe Surfaceif Special Finish Isto Beprovided Andcuringetc.Complete. ( Excluding Reinforcement, Including Cover Block ) . ( Newly Laidconcreteshallbecoveredbygunnybag, Plastic, Tarpaulin Etc. ) With Fullyautomatic Microprocessorbasedplcwithscadaenabledreversibledrum Typemixer / Concretebatchmixplant ( Panmixer ) Etc.Complete.Withfineaggregate ( Crushedsandvsi G D ) 553 Providing And Laying Cast In Situ / Ready Mix Cement Concreteinm-20 Of Trap / Granite / Gneiss / Quartzite Metal For R.C.C. Arches With Skew Backs As Per Detailed Design And Drawings Or As Directed Including Steelcentering, Plywood / Steelformwork, Steelprops, Laying / Pumping, Compaction, Finishingunevenand Honeycombed Surface With C.M. 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening The Surface If Special Finish Is To Be Provided And Curing Etc. Complete. ( Excluding Reinforcement, Including Cover Block ) . Newly Laid Concrete Shall Be Covered By Gunny Bag, Plastic, Tarpaulin Etc. With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 554 Providing And Laying Cast In Situ / Ready Mix Cement Concreteinm-25 Of Trap / Granite / Gneiss / Quartzite Metal For R.C.C. Arches With Skew Backs As Per Detailed Design And Drawings Or As Directed Including Steelcentering, Plywood / Steelformwork, Steelprops, Laying / Pumping, Compaction, Finishingunevenand Honeycombed Surface With C.M. 1:3 Of Sufficient Minimum Thickness To Give A Smooth And Even Surface Or Roughening The Surface If Special Finish Is To Be Provided And Curing Etc. Complete. ( Excluding Reinforcement, Including Cover Block ) . Newly Laid Concrete Shall Be Covered By Gunny Bag, Plastic, Tarpaulin Etc. ( Wooden Centering Will Not Be Allowed ) With Fine Aggregate ( Crushed Sand Vsi Grade ) 555 Providingandlayingcastinsitu / Readymixcementconcretein M-20Oftrap / Granite / Gneiss / Quartzitemetalforr.C.C.Finsofrequiredthicknessinpositionasshownonthe Drawings Orasdirectedbyengineer-In-Chargeincludingsteelcentering, Plywood / Steel Formwork, Steelprops, Laying / Pumping, Compaction, Finishing Uneven And Honeycombedsurfacewithc.M.1:3Ofsufficient Minimumthicknesstogiveasmoothandevensurfaceorrougheningthesurfaceifspecialfinishistobe Provided And Curing Etc. Complete. ( Excluding Reinforcement, Including Coverblock ) Newlylaidconcrete Shallbe Coveredby Gunnybag, Plastic, Tarpaulin Etc. With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 556 Providingandlayingcastinsitu / Readymixcementconcretein M-25Oftrap / Granite / Gneiss / Quartzitemetalforr.C.C.Finsofrequiredthicknessinpositionasshownonthe Drawings Orasdirectedbyengineer-In-Chargeincludingsteelcentering, Plywood / Steel Formwork, Steelprops, Laying / Pumping, Compaction, Finishing Uneven And Honeycombedsurfacewithc.M.1:3Ofsufficient Minimumthicknesstogiveasmoothandevensurfaceorrougheningthesurfaceifspecialfinishistobe Provided And Curing Etc. Complete. ( Excluding Reinforcement, Including Coverblock ) Newlylaidconcrete Shallbe Coveredby Gunnybag, Plastic, Tarpaulin Etc. With Fully Automatic Micro Processor Based Plc With Scada Enabled Reversible Drum Type Mixer / Concrete Batch Mix Plant ( Pan Mixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 557 Providing And Fixing In Position Tmt - Fe - 500 Bar Reinforcement Of Various Diameters Forr.C.C. Pile Caps, Footings, Foundations, Slabs, Beams Columns, Canopies, Staircase, Newels, Chajjas, Lintels Pardis, Copings, Fins, Arches Etc. As Per Detailed Designs, Drawings Andschedules.Including Cutting, Bending, Hooking The Bars, Binding With Wires Or Tack Welding And Supporting As Required Complete. 558 Providingandfixinginpositionhcrm / Crs ( Corrosion Resistantsteel ) Barreinforcementof Various Diameters For R.C.C. Pile Caps, Footings, Foundations, Slabs, Beams Columns, Canopies, Staircase, Newels, Chajjas, Lintelspardis, Copings, Fins, Archesetc.Asperdetailed Designs, Drawings And Schedules. Including Cutting, Bending, Hooking The Bars, Binding With Wires Or Tack Welding And Supporting As Requiredomplte 559 Providing And Applying Anti Corrosivetreatment To Reinforcement As Per Cement Polymercomposite Coating ( C.P.C.C. ) Method Developed By C.E.C.R.I. Including Cleaning The Bar By Meansofanyestablished Mechanicalormanualmethodforremovingrustanddeleterious Material, Applyingrapidsettingprimer Andcementpolymersealingcoatofapproved And Licensed By Cecri Including Redoing The Process If Damage Occurs During Handling, Stacking Etc. Complete. ( With Prior Approval Of Se ) 560 Providing Fusion Bonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 8Mmdiameter As Per Is:13620-1993 Specifications For A Thickness Of 175Micron Permissible Variation Of 50Micron Includingtestingof Coating At Plant, Including Cost Forcareful Handling Using Pvccoating, Binding Wiresinstead Of G. I. Wires To And From Plant ) Touching Up The Materialsuppliedrepairworketccompleteasperdetailed Specifications. ( Lead 200Km From Plant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note:Theitemshouldbeexecutedwithpriorapprovalofsuperintendingengineer.Frequencyof Test Of Fusion Bonded Epoxy Coata ) Coating Thickness Shall Be Tested At A Frequency Of Not Less Than One Full Length Bar Every Twenty Bars For Each Sizeb ) Continuity Of Coating Shall Be Determined By Testing One Full Length Bar In Every Twenty Bars For Each Sizec ) Coatingthicknessoverthewholeofthecoatedbarsectionshallbedeterminedby Sectioning And Examining One Bar In Every Twenty Tonnes For Each Size.D ) For Testing Adhesion Of Coating, Samples Shall Be Selected From Each Size According To The Frequency Given Below:Nominal Size Of Bar, Mm Number Of Samplesfor All Types Of Bar : Minimum 1 For Every Diameter Or As Directed By Engineer In Charge 561 Providing Fusionbonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 10Mmdiameteras Per Is: 13620- 1993Specificationsforathicknessof175micronpermissiblevariationof50micron Includingtestingof Coating At Plant, Including Cost Forcareful Handling Using Pvccoating, Binding Wiresinstead Of G. I. Wires To And From Plant ) Touching Up The Materialsuppliedrepairworketccompleteasperdetailed Specifications. ( Lead 200Km From Plant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note:Theitemshouldbeexecutedwithpriorapprovalofsuperintendingengineer.Frequencyof Test Of Fusion Bonded Epoxy Coata ) Coating Thickness Shall Be Tested At A Frequency Of Not Less Than One Full Length Bar Every Twenty Bars For Each Sizeb ) Continuity Of Coating Shall Be Determined By Testing One Full Length Bar In Every Twenty Bars For Each Sizec ) Coatingthicknessoverthewholeofthecoatedbarsectionshallbedeterminedby Sectioning And Examining One Bar In Every Twenty Tonnes For Each Size.D ) For Testing Adhesion Of Coating, Samples Shall Be Selected From Each Size According To The Frequency Given Below:For All Types Of Bar : Minimum 1 For Every Diameter Or As Directed By Engineer In Charge 562 Providing Fusionbonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 12Mmdiameteras Per Is: 13620- 1993Specificationsforathicknessof175micronpermissiblevariationof50micron Includingtestingof Coating At Plant, Including Cost Forcareful Handling Using Pvccoating, Binding Wiresinstead Of G. I. Wires To And From Plant ) Touching Up The Materialsuppliedrepairworketccompleteasperdetailed Specifications. ( Lead 200Km From Plant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note:Theitemshouldbeexecutedwithpriorapprovalofsuperintendingengineer.Frequencyof Test Of Fusion Bonded Epoxy Coata ) Coating Thickness Shall Be Tested At A Frequency Of Not Less Than One Full Length Bar Every Twenty Bars For Each Sizeb ) Continuity Of Coating Shall Be Determined By Testing One Full Length Bar In Every Twenty Bars For Each Sizec ) Coatingthicknessoverthewholeofthecoatedbarsectionshallbedeterminedby Sectioning And Examining One Bar In Every Twenty Tonnes For Each Size.D ) For Testing Adhesion Of Coating, Samples Shall Be Selected From Each Size According To The Frequency Given Below:For All Types Of Bar : Minimum 1 For Every Diameter Or As Directed By Engineer In Charge 563 Providing Fusionbonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 16Mmdiameteras Per Is: 13620- 1993Specificationsforathicknessof175micronpermissiblevariationof50micron Includingtestingof Coating At Plant, Including Cost Forcareful Handling Using Pvccoating, Binding Wiresinstead Of G. I. Wires To And From Plant ) Touching Up The Materialsuppliedrepairworketccompleteasperdetailed Specifications. ( Lead 200Km From Plant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note:Theitemshouldbeexecutedwithpriorapprovalofsuperintendingengineer.Frequencyof Test Of Fusion Bonded Epoxy Coata ) Coating Thickness Shall Be Tested At A Frequency Of Not Less Than One Full Length Bar Every Twenty Bars For Each Sizeb ) Continuity Of Coating Shall Be Determined By Testing One Full Length Bar In Every Twenty Bars For Each Sizec ) Coatingthicknessoverthewholeofthecoatedbarsectionshallbedeterminedby Sectioning And Examining One Bar In Every Twenty Tonnes For Each Size.D ) For Testing Adhesion Of Coating, Samples Shall Be Selected From Each Size According To The Frequency Given Below:For All Types Of Bar : Minimum 1 For Every Diameter Or As Directed By Engineer In Charge 564 Providing Fusionbonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 20Mmdiameteras Per Is: 13620- 1993Specificationsforathicknessof175micronpermissiblevariationof50micron Includingtestingof Coating At Plant, Including Cost Forcareful Handling Using Pvccoating, Binding Wiresinstead Of G. I. Wires To And From Plant ) Touching Up The Materialsuppliedrepairworketccompleteasperdetailed Specifications. ( Lead 200Km From Plant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note:Theitemshouldbeexecutedwithpriorapprovalofsuperintendingengineer.Frequencyof Test Of Fusion Bonded Epoxy Coata ) Coating Thickness Shall Be Tested At A Frequency Of Not Less Than One Full Length Bar Every Twenty Bars For Each Sizeb ) Continuity Of Coating Shall Be Determined By Testing One Full Length Bar In Every Twenty Bars For Each Sizec ) Coatingthicknessoverthewholeofthecoatedbarsectionshallbedeterminedby Sectioning And Examining One Bar In Every Twenty Tonnes For Each Size.D ) For Testing Adhesion Of Coating, Samples Shall Be Selected From Each Size According To The Frequency Given Below:Foralltypesofbar:Minimum1foreverydiameterorasdirectedbyengineerin Chargecharge 565 Providing Fusionbonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 25Mmdiameteras Per Is: 13620- 1993Specificationsforathicknessof175micronpermissiblevariationof50micronincludingtestingof Coating At Plant Extra Cost For Careful Handling Using Pvc Coating, Bindingwiresinsteadofg.I.Wiresto And From Plant ) Touching Up The Material Suppliedrepair Work Etc Complete As Per Detailed Specifications. ( Lead200kmfromplant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note : The Item Should Be Executed With Prior Approval Of Superintending Engineer. Charge 566 Providing Fusionbonded Epoxy Coating ( Fbec ) To Reinforced Bars Of 32Mmdiameteras Per Is: 13620- 1993Specificationsforathicknessof175micronpermissiblevariationof50micronincludingtestingof Coating At Plant Extra Cost For Careful Handling Using Pvc Coating, Bindingwiresinsteadofg.I.Wiresto And From Plant ) Touching Up The Material Suppliedrepair Work Etc Complete As Per Detailed Specifications. ( Lead200kmfromplant ) Etc Complete. ( Item Shall Be Used For New Structures. ) Note:Theitemshouldbeexecutedwithpriorapprovalofsuperintendingengineer.Frequencyof Test Of Fusion Bonded Epoxy Coata ) Coating Thickness Shall Be Tested At A Frequency Of Not Less Than One Full Length Bar Every Twenty Bars For Each Sizeb ) Continuity Of Coating Shall Be Determined By Testing One Full Length Bar In Every Twenty Bars For Each Sizec ) Coatingthicknessoverthewholeofthecoatedbarsectionshallbedeterminedby Sectioning And Examining One Bar In Every Twenty Tonnes For Each Size.D ) For Testing Adhesion Of Coating, Samples Shall Be Selected From Each Size According To The Frequency Given Below:For All Types Of Bar : Minimum 1 For Every Diameter Or As Directed By Engineer In Charge 567 Providing And Fixing In Position After Hoisting, Precast 1:2 Cement Mortar Reinforced Jali 50 Mm Thick With 3 Mm Diameter Mild Steel Bar Reinforcement, Of Approved Design On Both Side, Fixing In Cement Mortar 1:3 Andcuring Etc. Complete 568 Providing And Fixing In Position After Hoisting, Precast 1:2 Cement Mortar Reinforced Jali 80 Mm Thickwith 3 Mm Diameter Mild Steel Bar Reinforcement, Of Approved Design On Both Sides, Fixing In Cement Mortar 1:3 Andcuring Etc .Complete. 569 Providing And Laying Cast In Situ / Ready Mix C.C. M-20 Of Trap Metal For Rcc Rectangular Gridbeamwith Slab As Per Detailed Design And Drawing, Steel Centering, Formwork, Coverblocks, Laying / Pumping, Compacting, Curing, Finishing And Roughening Them To Form Surface Withc.M.1:3Ofsufficientminimum Thicknesstogivesmoothandevensurfaceor Rougheningthemifspecialfinishistobeprovidedand Curingcomplete ( Excluding Reinforcementandstructuralsteel ) .With Fullyautomaticmicroprocessor Basedplcwith Scadaenabledreversibledrumtypemixer / Concretebatchmixplant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 570 Providing And Laying Cast In Situ / Ready Mix C.C. M-25 Of Trap Metal For Rcc Rectangular Grid Beam With Slabasperdetaileddesignanddrawingorasdirectedincludingdewateringifnecessary, Steelcentering, Formwork, Cover Blocks, Laying / Pumping, Compacting, Finishing The Form Surface With C.M. 1:3 Of Sufficient Minimumthicknesstogivesmoothandevensurfaceor Roughening Them If Special Finish Is To Be Provided And Curing Complete ( Excludingreinforcement And Structural Steel ) . With Fully Automatic Microprocessorbasedplcwith Scadaenabledreversibledrumtypemixer / Concretebatchmix Plant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 571 Providing And Laying Cast In Situ / Ready Mix C.C. M-30 Of Trap Metal For Rcc Rectangular Grid Beam With Slabasperdetaileddesignanddrawing Orasdirectedincluding Dewatering Ifnecessary, Steel Centering, Formwork, Cover Blocks, Laying / Pumping, Compacting , Curing , Finishingandrougheningthem Toform Surface With C.M. 1:3 Of Sufficient Minimum Thickness To Give Smooth And Even Surface Or Roughening Them If Special Finish Is To Be Providedand Curingcomplete ( Excludingreinforcementandstructuralsteel ) .With Fully Automaticmicro Processor Based Plc With Scada Enabled Concrete Batch Mix Plant ( Pan Mixer ) . With Fine Aggregate ( Crushed Sand Vsi Grade ) 572 Providing And Laying Cast In Situ / Ready Mix C.C. M-35 Of Trap Metal For Rcc Rectangular Grid Beam With Slabasperdetaileddesignanddrawingorasdirectedincludingdewateringifnecessary, Steelcentering, Formwork, Cover Blocks, Laying / Pumping, Compacting, Finishing The Form Surface With C.M. 1:3 Of Sufficient Minimumthicknesstogivesmoothandevensurfaceor Roughening Them If Special Finish Is To Be Provided And Curing Complete ( Excludingreinforcement And Structural Steel ) . With Fully Automatic Microprocessorbasedplcwith Scadaenabledreversibledrumtypemixer / Concretebatchmix Plant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 573 Providing And Laying Cast In Situ / Ready Mix C.C. M-40 Of Trap Metal For Rcc Rectangular Grid Beam With Slabasperdetaileddesignanddrawingorasdirectedincludingdewateringifnecessary, Steelcentering, Formwork, Cover Blocks, Laying / Pumping, Compacting, Finishing The Form Surface With C.M. 1:3 Of Sufficient Minimumthicknesstogivesmoothandevensurfaceor Roughening Them If Special Finish Is To Be Provided And Curing Complete ( Excludingreinforcement And Structural Steel ) . With Fully Automatic Microprocessorbasedplcwith Scadaenabledreversibledrumtypemixer / Concretebatchmix Plant ( Panmixer ) Etc. Complete. With Fine Aggregate ( Crushed Sand Vsi Grade ) 574 Providing And Fixing During Laying In Rcc Slabrectangular 2 Mm Thickm.S. Sheet Fan Hook Box Ofsize 180X100 Mm With Requireddepth Withholes Or Notches As Required, Bottom And Topsides Of 1.6 Mm M.S. Sheetfixedwith3.5Mm Dia.Roundheadedscrewstogetherwith12mm Dia.M.S.Barbenttoshapewithhooked Ends For Fan Hook And Painting To Exposed Surface 575 Providing Secondclassburntbrickmasonrywithconventional / I.S.Typebricksincement Mortar 1:6 Infoundationsandplinthofinnerwalls / Inplinthexternalwallsincludingbailingoutwatermanually, Striking Joints On Unexposedfaces, Raking Out Joints On Exposedfaces And Watering Etc. Complete. 576 Providingfirstclassburntbrickmasonrywithconventional / I.S.Typebricksincement Mortar 1:6 In Plinth Including Bailing Out Water Manually, Striking Joints On Unexposed Faces, Pointing With Cement Mortar1 3 On Exposed Face And Watering Etccomplete 577 Providing Secondclassburntbrickmasonrywithconventional / I.S.Typebricksincement Mortar 1:6 Inplinth As Backing Incomposite Masonry Including Bailing Out Water Manually, Striking Joints, Raking Outjoints And Watering Etc Complete 578 Providing Secondclassburntbrickmasonrywithconventional / I.S.Typebricksincement Mortar1:6 Insuperstructureincludingstrikingjoints, Rakingoutjoints, Wateringandscaffolding Etc. Complete 579 Providing Secondclassburntbrickmasonrywithconventional / I.S.Typebricksincement Mortar 1:4 In Half Brick Thick Wall Including Mild Steel Longitudinal Reinforcement Of 2 Bars Of 6 Mm Diameter / 2 Hoop Ironstrips25mm X1.6Mm Placed Ateverythirdcourse, Properlybentandbondedatendsscaffolding, Racking Out Joints And Watering Etc. Complete. 580 Providingburntbrick-On-Edgemasonrywithsecondclassbricksofconventionaltypebricksin Cement Mortar1:3 Includingmildsteellongitudinalreinforcementof2bars Of6mm Diameter / One Strips Of Hoopiron25mm X1.6Mm Placedateverythirdcourse, Properlybentandbondedatends, Scaffolding, Raking Out Joint And Watering Etccomplete 581 Providingfirstclassburntbrickmasonrywithconventional / I.S.Typebricksincement Mortar1:4 Includingscaffolding, Rackingoutjointspointinginc.M.1:3Andwateringin Pillars Of Rectangular Orsquare Shape As Shown On The Drawing Or As Directed Etc.Complete. 582 Providingfirstclassbrickmasonrywithconventional / Is.Typebricksincementmortar1:4Including Scaffolding, Racking Out Joints Pointing In C.M 1:3 And Watering Etc. In Pillars Of Curved Shapes, As Shown Onthe Drawing Or As Directed Etccomplete 583 Providingsecondclassburntbrickmasonrywith Conventional / I.S.Typebricksincementmortar1:4Includingscaffolding, Rackingoutjointsandwateringetc.Inpillarofrectangularshapesasshowninthe Drawings Or As Directed Complete. 584 Providingsecondclassburntbrickmasonrywith Conventional / I.S.Typebricksincementmortar1:4 Including Scaffolding, Racking Out Joints And Watering Etc.In Pillar Of Curved Shapes As Shown In The Drawingor As Directed Complete. 585 Providing Fly Ash Brick Masonry With Conventional / I.S. Type Fly Ash Bricksin C.M. 1:6 In Foundation And Plinth Includingbailing Out Water Manually Striking Joints, Racking Out Joints Watering And Scaffolding Etc. Complete. 586 Providing Fly Ash Brick Masonry With Conventional / I.S. Type Bricks In Cement Mortar 1:6 In Superstructure Includingstrikingjoints, Rakingoutjoints, Wateringandscaffoldingetc. Complete 587 Providing Second Class Fly Ash Brick Masonry With Conventional / I.S. Type Bricks In Cement Mortar 1:4 In Half Brick Thick Wall Including Mild Steel Longitudinal Reinforcement Of Two Bars Of 6 Mm Diameter / Two Hoop Iron Strips 25 Mm X 1.60 Mm At Every Third Course, Properly Bent And Bounded At Ends Scaffolding Raking Out Jointsand Watering Etc. Complete. 588 Providingautoclavedaeratedconcreteblockmasonaryof Conforming To Is:2185 ( Part 3 ) - 1984 In Extra Fine Jointing Mortar Of Fixoblock Of Ultratech Or Equivalent In Superstructure Including Striking Joints, Raking Out Joints And Scaffolding Etc. Complete. ( The Test Shall Be Carried Out Conforming To Is:6441 ( Part I ) - 1972 ) 589 Providing Autoclaved Aerated Concrete Block Masonary Of Conformingtois:2185 ( Part3 ) -1984In Extrafinejointingmortaroffixoblockofultratechor Equivalent In Half Brick Thick Wall Including Strikingjoints, Rakingoutjointsand Scaffolding Etc. Complete. ( The Test Shall Be Carried Out Conforming Tois 6441 ( Part I ) - 1972 ) 590 Providinguncoursedrubblemasonryoftrap / Granite / Quartzite / Gneissstonesincement Mortar1:6 In Foundation And Plinth Of Inner Walls / In Plinth Of External Walls Includingbailingoutwater Manually , Striking Joints On Un Exposed Faces And Watering Etc.Complete. 591 Providinguncoursedrubblemasonryoftrap / Granite / Quartzite / Gneissstonesincement Mortar 1:5 Inbasements Including Scaffolding, Bailing Out Water Manually, Racking Out Joints Whenplastering Is Tobe Done Striking Joints Where No Pointing Or Plastering Is To Be Done And Watering Etc.Complete. 592 Providinguncoursedrubblemasonryoftrap / Granite / Quartzite / Gneissstoneincement Mortar1:3 Inbasementwithpatentwaterproofingcompoundaddedtoitatrateof 1Kilogramperbag Ofcement Includingbailingout Water Manually, Scaffoldingrackingoutjointswhenplasteringistobedoneandt I T Lt 593 Providinguncoursedrubblemasonryoftrap / Granite / Quartzite / Gneissstonesincement Mortar1:6 Insuperstructureincludingrackingoutjointswhenplasteringistobedone / Strikingjointswhen No Plasteringistobedoneoninsidewateringand Scaffoldingetc.Complete. 594 Providing Random Rubble Masonry Second Sort Of Trap / Granite / Quartzite / Gneiss Stones In Cementmortar 1:6 In Plinth Including Bailing Out Water Manually, Striking Joints Onunexposedfaces. ( Excludingpointing ) Etc.Complete. 595 Providing Random Rubble Masonry Second Sort Of Trap / Granite / Quartzite / Gneiss Stones In Cement Mortar 1:6 Insuperstructurerackingoutjointswhenplasteringistobedone / Strikingjoints When No Pointingor Plastering Isto Bedone Onthe Insidewatering Andscaffolding Etc.Complete. 596 Providing Random Rubble Masonry First Sort Of Trap / Granite / Quartzite / Gneiss Stones Incement Mortar1:6Inexternalwallsofplinthincludingbailingoutwatermanually, Rackingout Joints When Pointingistobedoneandstrikingjointsfrominsideincludingwateringtlt 597 Providing Random Rubble Masonry First Sort Of Trap / Granite / Quartzite / Gneiss Stones Incement Mortar1:6Insuperstructureincludingbailingoutwatermanually , Rakingoutjointsfrom Outside And Striking Joints When No Pointing Or Plastering Is To Be Done From Insidewateringandscaffoldingetc.Complete. 598 Providing Coursed Rubble Masonry Second Sort Of Trap / Granite / Quartzite / Gneiss Stones In Cement Mortar 1:6 In External Walls Of Plinth Including Bailing Out Water Manually , Striking Joints Inside And Raking Out Jointsfrom Outside And Watering Etc.Complete 599 Providing Coursed Rubble Masonry Second Sort Of Trap / Granite / Quartzite / Gneiss Stones In Cement Mortar 1:6 Insuperstructureincludingrakingoutjointswhenplasteringistobedoneand Striking Joints When No Plasteringistobedoneontheinside, Wateringscaffolding Etc.Complete. 600 Providing Coursed Rubble Masonry First Sort Of Trap / Granite / Quartzite / Gneiss Stones Incement Mortar 1:6 In External Work Of Plinth Including Bailing Out Water Manually, Striking Joints Inside And Wateringetc.Complete. 601 Providing Coursed Rubble Masonry First Sort Of Trap / Granite / Quartzite / Gneiss Stones Incement Mortar 1:6 In Superstructure Including Racking Out Joints On The Inside When Plastering Is To Be Done, Wateringand Scaffolding Etc. Complete. 602 Providingcoursedrubblemasonryfirstsortforpillarsoftrap / Granite / Quartzite / Gneiss Stonesin Cementmortar1:6Includingpointingwithcementmortar1:3Scaffoldingandwatering Etc.Complete. 603 Providing And Laying Masonry Of I.S. Standard C.C. Hollow Block 100 X 200 X 400 Mm With 100Mm Thick In Cement Mortar 1:6 Proportion For Superstructure Including Curing, Scaffoldingetc. Complete. 604 Providingandlayingmasonryofi.S.Standardc.C.Hollowblock200x200x400with200mmthickmmincementmortar1:6Proportionforsuperstructureincludingcuring, Scaffolding Etc. Complete 605 Providing Andconstructing Masonry Inprecast Solidconcrete Block ( Grade D-50As Per I.S. 2185, Part-I, 1974, Reframed 1987 ) Having Compressive Strength 5-00 N / Mm2 ) Of Size ( 300 Mm X 200 Mm X 150Mm ) In Cementmortar1:6Forsuperstructureincludingstrikingjointsonunexposed Faces, Rackingoutjointson Exposedfaces, Watering, Curing Andscaffolding Etc. Complete. 606 Providingandconstructingmasonryinautoclavedareaclaved ( Celluar ) Concreteblockofaproved Manufacturer Confirming To Is 2185 Part Iii 1984 Of Size ( 625X240x225 ) Mm In Extra Fine Jointing Mortar Of Fixoblockofinfoundaionsandplinthofinnerwalls / In Plinth External Walls Including Bailing Out Water, Strikingjointsonunexposed Faces, Racking Out Joints On Exposed Faces And Watering Etc.Complete 607 Providingandconstructingmasonryinautoclavedareaclaved ( Celluar ) Concreteblockofaproved Manufacturer Confirming To Is 2185 Part Iii 1984 Of Size ( 625X240x225 ) Mm In Extra Fine Jointing Mortar Offixoblockof Insuperstuctureincluding, Striking Joints, Rackingoutjointswatering Andscaffoldingetc Complete 608 Providingandconstructingmasonryinautoclaved Areaclaved ( Celluar ) Concreteblockofaproved Manufacturer Confirming To Is 2185 Part Iii 1984 Of Size ( 625X 240X100 ) Mm In Extra Fine Jointing Mortar Of Fixoblockofinhalfbrickthickwallincluding2hoop Iron Strips25mmx1.6Mmateverythird Course, Properlybendandbondedatends Scaffolding Racking Out Joints And Watering Compete 609 Providing Green Build Product ( Gbp ) Build Fast Plus Masonry Ecofriendly Wet Mix / Blocks Layingadhesive Isapre-Polymerized, Wetmixjointingadhesivewhichissuitablefor Building Masonry Walls With All Kind Of Blocks With Thickness Of Thin Layer Of 2Mm To 4Mm Between Masonry Units. There Is No Need To Pre- Wetthe Blocksnortopostcure The Wallwithwater.Confirming Tois2185ofsize 75X240x650mm In Superstructure Including Striking Joints, Racking Outjoints Faces And Scaffolding Etc. Complete. 610 Providing Green Build Product ( Gbp ) Build Fast Plus Masonry Ecofriendly Wet Mix / Blocks Of Size 100 X 240 X 650 Mm Laying Adhesive Is A Pre-Polymerized, Wet Mix Jointing Adhesive Which Is Suitable For Building Masonry Walls With All Kind Of Blocks Withthickness Of Thin Layer Of 2Mm To 4Mm Between Masonry Units. There Is No Need To Pre-Wet The Blocks Nor To Post Curethewallwithwater.Confirmingtois2185of Sizeinsuperstructureincluding Striking Joints, Racking Out Joints Faces And Scaffolding Etc. Complete. 611 Providing Green Build Product ( Gbp ) Build Fast Plus Masonry Ecofriendly Wet Mix / Blocks Of Size 200 X 240 X 650 Mm Laying Adhesive Is A Pre-Polymerized, Wet Mix Jointing Adhesive Which Is Suitable For Building Masonry Walls With All Kind Of Blocks Withthickness Of Thin Layer Of 2Mm To 4Mm Between Masonry Units. There Is No Need To Pre-Wet The Blocks Nor To Post Curethewallwithwater.Confirmingtois2185of Sizeinsuperstructureincluding Striking Joints, Racking Out Joints Faces And Scaffolding Etc. Complete. 612 Providing Expansionjoints Inr.C.C. Framedstructure ( Interior Column ) Withplainpremoulded Filler 25 Mm Thick Including Fixing T.W. Battens On Both Faces And Finishing Asdirected Etc. Complete. 613 Providing Expansionjoints Inr.C.C. Framedstructure ( Exterior Columns ) Withplainpremoulded Filler25mmthickand3mmthickalluminiumplate, Holdfast, Fixingt.W. Battens On Internal Face, Finishing Etccomplete As Directed 614 Providing Expansion Joints In R.C.C. Framed Structure ( At Floor Level ) With Premoulded Filler 25 Mm Thick And 3Mm Thickaluminiumplateasrequired, Bitumenpouredfillerandfixingt.W.Battensonrearfacesetc.Complete As Directed 615 Providing Expansion Joints In R.C.C. Framed Structure ( At Terrace Level ) With Premoulded Filler 25 Mm Thick And3 Mm Thick Aluminium Plate As Required, Bituminous Pouredfiller, Fixing Lead, Flashing On Upper Sideand T.W. Battens On Inner Face Finishing Etc. Complete As Directed. 616 Providingexpansionjointsinreinforcedcementconcreteframedstructure ( Interiorcolumns ) With Plain Premouldedfiller Withconfirmingtois1838, 1961, 25Mm Thickwith75mm Wide And 1 Mm Thickstainless Steel Plate Finishing Etc. Complete As Directed 617 Providing Expansion Joints In R.C.C. Framed Structure ( Exterior Column ) With Plainpremouldedfiller25mm Thickwith75mm Wide And1mm Thickstainlesssteelplateand Finishing Etc. Complete. 618 Providing Expansion Joints In R.C.C. Framed Structure ( At Floor Level ) With Plain Premouldedfiller25mm Thickwith75 Mm Wide And1 Mm Thick Stainlesssteel Platandfinishing Etc. Complete. 619 Providingexpansionjointsinr.C.C.Framedstructure ( Atterracelevel ) Withpremoulded Filler 25 Mmthick With 40 Mm Wide And 1 Mm Thick Stainless Steel Plate As Required, Bitumen Poured Filler And Finishing Etccomplete As Directed 620 Providing And Fixing Of Bituflex Close Cell Foam Of Size 30 Mm X 30 Mm In Double Layerinthe Expansion Joints Inr.C.C Framedstructure ( Atfloor Level / Atterracelevel / Interiorcolumns ) For Overlapping Ofclosedcellfoam Joints, Applying Tp-40Primeron Both The Sides Of Concrete Surface, Filling The 25 Mm X 25 Mm Gapwith The Polydee-41 Highly Flexible Sealant And Covering The Joint Withpolydee-Lm, 150 Mm Width In 2 Coats Etc. Complete. 621 Providing And Fixing Of Bituflex Close Cell Foam Of Size 30 Mm X 30 Mm In Double Layer In The Expansion Joints Inr.C.C. Framedstructure ( Exteriorcolumn ) With Closed Cellfoam , Applyingtp-40 Primer On Both The Sides Of Concrete Surface, Filling The 25 Mm X 25 Mm Gap With The Polyseal, Highly Flexiblesealantandcoveringthejointwith Polydee-Lm, 150 Mmwidth In2coatsand Fixingthe Aluminium Plate Of 100 Mm Wide And3mm Thick On External Face Of Column Etc. Complete.Note- For Item Number 9 And 10 Prior Approval Of Superintending Engineer Is Necessary Before Execution Of Work. 622 Providing And Fixingbituminous Pad 25Mmthick For Expansion Jointsin Retainingwall, Compound Wall Etc. Complete. 623 Providingandlayingdampproofcourse50mmthickinm20cementconcretelayerand Bitumen / Using Cement With Waterproofing Compound Curingformwork Etc. Complete. 624 Providingandapplyingbitumenvg30 / Vg40layerat2kilogram.Persquaremeterovertheterrace, Structural Slab Including Cleaning The Surface For Waterproofing As Directed Complete 625 Providing Leak Proof Treatment By Injectiongrouting Methodto Oldfloor Withoutremoving Tiles Of W.C., Bath, Withcementsandproportionof1:1.5Andwaterproofingcompoundat2kilogram / Bag Of Cement Mixed In 35 Liters Of Water Including Drilling Holes In Requiredpositiongroutingwithabovemixedsolution And Ceiling Etccomplete 626 Providing Cement Based Water Proofing Treatment To Terraces ( Indian Water Proofing Or Alike ) With Brick Bats Laidinrequiredslopetodrainthewaterforanyspanaftercleaningthebasesurface.Applyingacoatof Cement Slurry Admixed With Approved Water Proofing Compound And Laying The Brick Bats On Bottom Layer In C.M.1:5 Admixed With Approved Water Proofing Compound Filling Up To Half Depth Of Brick Bats, Curing This Layerfor3days, Applyingcementslurryoverthislayerjointsofbrickbatswithc.M.1:3Admixedwith Approved Water Proofing Compound And Finally Top Finishing With Average 20 Mm. Thick Layers Of Same Mortar Added With Jute Fiber At 1Kilogramper Bag Including Finishing The Surface Smooth With Cement Slurry Admixed Withapprovedwaterproofingcompound.Markingfinishedsurfacewithfalse Squares Of 300Mm X 300 Mm. Making The Junctions At The Parapet Rounded And Tapered Top For Requiredheight, Withdripmouldat Thejunctionofplasterandparapetandcuringand Covering10yearsguaranteeagainstleakproofness Oncourtfeestamppaperofrs.500 / - Including Ponding Test Etc. Complete. 627 Providingwaterproofbeddingforflooringofbath Andwc 25 Mmthickin C.M.1:3Including Using Approved Water Proofing Compound In Specified Proportion As Per Manufacturers Specifications For Per Bag Of Cement Including Leveling, Curing And Covering 10 Years Guarantee On Court Feestamp Paper Of Rs 500 / - Including Ponding Test Etccomplete 628 Providingwaterproofplasterinw.C.Andbath 12Mmthickfordadoincementmortar1:3Withneat Finishing, Floating Using Waterproofing Compound At The Rate Of 1 Kilogram. Per Bag Of Cement Of Approved Make And Manufacturer And Curing Etc. Complete. ( Excluding Tiles ) ( As Directed By Engineer In Charge ) 629 Providingwaterproofplasterinw.C.Andbath 20Mmthickfordadoincementmortar1:3Withneat Finishing, Floating Using Waterproofing Compound At The Rate Of 1 Kilogram. Per Bag Of Cement Of Approved Makeandmanufacturerandcuring ( Andfillingjointsofnahanitrapand Anyoutletbyproperly ) Etc.Lt 630 Removing The Tar Or Coba And Disposing Of The Material As Directed Etc. Complete. 631 Providingandapplyingwaterproofingtreatmentusingacrylicpolymermodifiedcement Basedwater Proofing Coating With Fibre Glass Mesh Mixing At The Rate Of Powder To Liquid ( 2:1 ) By Weight Covering9to10squaremetre / Kilogramwithtwocoatusingapproved Chemicals For Masonry And Concrete Surface By Brush Covering 7 Years Guarantee On Stamp Papers Etc. Complete. 632 Providingandlayingjointlesspolydee-Lm, Ahighlyflexibleelastometriccoatingforrcc / Cementitious Surface For Terrace Waterproofing On B.B. Coba / R.C.C, After Application Of Tp- 42 Primer On Perfectly Clean Surface ( Free From Loose Dust And Foreign Matter ) Application Of 1St Coat Of Polydee-Lm @ 700 Gms / Square Metre And Applying 2Nd Coat Of Polydee-Lm @ 700 Gms / Square Metre And Finishing The Same With Sprinkling The Ag-10 Granules On The Wet Coating. ( After Finishing Covering The Treatment With 25Mm Cement Plaster For Protection With Fibrillated 6Mm Plyplast Fibre @ 125 Gms / Square Metre To Be Paid In Separate Item. ) Covering 7 Years Guarantee On Court Fee Stamp Paper Of Rs. 100 / - Etc. Complete. 633 Providing And Applying A Base Coat Comprising Of 1Kilogrampolydee-Mc And 1Kilogramfreshcement After Wetting The Surface Followed By Drying The Surface For 2Days, Apply Primer Coatof Tp-40 And Afterdrying, Applyingpolydee-11 Twocomponent ( Mixingratio2a:1B ) ) Antibacterial Food Grade Coating Inside Drinking Water Tank In Two Coats With Time Interval Of Minimum 8 Hrs. Covering 7 Years Guarantee On Court Fee Stamp Paper Of Rs. 100 / - Etc. Complete. 634 Providingandfixing20to25mmthickroughshahabadboxtypewaterproofingforbasementor Underground Flooronabaseofcementconcrete1:3:6, Includingsub Baseof 2.50 Centimeter Thick Cement Mortar 1:3 With Conceal, Secrete ( Rmw ) , Algae Proof Or Other Alike Waterproofing Liquids, Raking Of Joints Upto 35 Mm Depth, Filling The Joints With6 Mm Size Crushed Metal, Hand Grouting With Cement Slurry, Curing And Cleaning, With 7 Years Guarantee On Court Fee Stamp Of Rs. 100 / - With Ponding Test Etc Complete. ( Excluding Cement Concrete 1:3:6 Base Concrete ) 635 Providing And Fixing 20 To 25 Mm Thick Rough Shahabad Box Type Waterproofing Treatment To Vertical Outside Faces Of Reinforced Cement Concrete Walls Of Basement Or Underground Floor Including Filling The Gapof 25 Mm Betweenrough Shahabadand R.C.C. Walls Withcement Grout Mixed With Water Proofing Liquid Algae Proof Or Other Alike With One Tile Lift Method, Brushingthejointshorizontallywithcementslurrymixed Withwaterproofingliquidfor Width 30 To 35 Mm And Sloping Coping Over Topmost Tile With Cement Mortar 1:3, Butting The Bottom Mostwithcementconcrete 1:2:4Mixedwithwaterproofing Liquid, Curing, With 7 Yearsguaranteeoncourtfeestampofrs.100 / -Withponding Testetccomplete. ( Excluding Cement Concrete 1:3:6 Base Concrete ) 636 Providingandlayingperforatedpvc160mmdiapipeinproperline, Levelandslopeincludingnecessary Material Fitting Etc. Complete. 637 Providingand Applyingrequired Coatsof Awater Based Uv Resistant Evercretetop Seal Sealant To Protect Natural Stone, Bricks, Concrete And Wooden Structures From Water Intrusion And Staining Due To Waterpenetration And Algue Formation Etc Complete 638 Providingandapplyingrequiredcoatsofawaterbasedevercretedeeppenetratingsealer ( Dps ) On Cementconcretesurfacelikeroads, Beams, Andcolumns, Plasteredwalls, Basements, Roofs, Potablewater Tanks Etc To React With Cement Andto Penetrate Concrete Structure Thereby Making It Resistant To Chemicals / Chlorides Water To Make It Dust Proof And To Act As A Water Resistant At The Same Time Which Strengthens The Treated Surface And Reduce The Curing Period Etc Complete. - Note -- For Item Number 7 To 4 Prior Approval Of Superintending Engineer Will Be Necessary 639 Providingwater Proofingtreatment Asper Is: 1346-1966 Togenerallyinaccessibleslopingreinforced Cement Concrete Terrace Slab With Bitumen Felts In All Positions In Five Course, Consisting Of Applying Cold Bitumenprimercoatattherateof2.5Litreper10squaremetre., Hotbitumenlayerattherateof 14.50Kilogramper 10 Square Metre. And Over The Same Layer Of Bitumen Felt Of Type Iii Grade ( I ) As Per Is: 1332-1965 Across The Slope With 10 Cm Overlap Commencing At Lowest Level And Again Applying Hot Bitumen Course At The Rate Of 14.50Kilogramper10squaremetre.Andfinallyspreadingoveritgrit Attherateof 14.50Kilogramper10squaremetre.Includingalllifts, Leadsandscaffoldingwhenever NecessarycompleteasdirectedwithfouryearsGuaranteeonrequisitestamppaperetc. Complete. 640 Providing Waterproofing In W.C. And Bath Including Brick Bat Coba In All Position Including Providingand Laying12mmbeddingincementmortor1:3Onverginconcreteslabwith Waterproofing Compound @ 1Kilogram / Perbagofcementlayingbrickbatcobaof Requiredthicknessincm1:5 With Waterproofing Compound1kilogram / Bag Ofcement Grouting And Finishing The Top Layer With 20Mm Thick Brick Bedding In Cm Mortor 1:3 With Waterproofing Compound 1 Kilogram / Per Bag Of Cement And Testing The Treated Portion For 48HoursbypondtestandcoveringtenyearsGuaranteeonrequisitestamppaperincludingcuringetc.Lt 641 Providing Internal Cement Plaster 6Mm Thick Ina Single Coat Incement Mortar 1:4 Without Neeru Finishtoconcrete Surface In All Positions Including Scaffolding And Curing Etc. Complete. 642 Providing Internal Cement Plaster 6Mm Thick Ina Single Coat Incement Mortar 1:3 Without Neeru Finishtoconcrete Surface In All Positions Including Scaffolding And Curing Etc. Complete. 643 Providinginternalcementplaster12mm Thickinsinglecoatincementmortar1:5Without Neeru Finish To Concrete Or Brick Surfaces, In All Positions Including Scaffolding And Curing Etc.Complete. 644 Providinginternalcementplaster12mm Thickinsinglecoatincementmortar1:4Without Neeru Finish To Concrete Or Brick Surfaces, In All Positions Including Scaffolding And Curing Etc.Complete 645 Providinginternalcementplaster12mm Thickinsinglecoatincementmortar1:3Without Neeru Finish To Concrete Or Brick Surfaces, In All Position Including Scaffolding And Curing Etc.Complete. 646 Providing Internal Cement Plaster 20Mm Thick Insingle Coats In Cement Mortar 1:5Withoutneeru Finish, To Concrete, Brick Surface, In All Positions Including Scaffolding And Curing Etc. Complete 647 Providing Internal Cement Plaster 20Mm Thick Insingle Coats In Cement Mortar 1:4Without Neerufinish, To Concrete, Bricksurface, Inallpositionsincludingscaffoldingandcuringetc.Complete. 648 Providing Internal Cement Plaster 20Mm. Thick In Single Coats In Cement Mortar 1:3 Withoutneeru Finish, To Concrete, Brick Surface, In All Positions Including Scaffolding And Curing Etc. Complete. 649 Providingsandfacedplasterexternallyincementmortarusingapprovedscreenedsand, Inallpositions Including Base Coat Of 15 Mm Thick In Cement Mortar 1:4 Using Waterproofingcompound At 1Kilogramper Cement Bag Curing The Same For Not Less Than 2 Days And Keeping Thesurfaceofthebasecoat Roughtoreceivethesandfacedtreatment6to8mm Thickin Cementmortar1:4Finishingthesurface Bytakingoutgrainsandcuringforfourteendays Scaffolding Etc.Complete. 650 Providing Rough Cast Cement Plaster Externally In Two Coats To Concrete, Brick Or Stonemasonry Surfaces In All Positions With Base Coat Of 12 To 15 Mm Thick In C.M. 1:4 And Rough Casttreatment12mm Thickinproportion1:11 / 2:3Including Scaffolding Andfourteendays Curing Complete. 651 Providingrough Cast Cementplaster Externallyin Twocoats With Coloured Cementfinish Toconcrete / Brick / Stone Masonry Surfaces In All Positions With Base Coat 12 To 15 Mm. Thick Inc.M. 1:4Using Gray Cement Andrough Cast Treatment 12Mm Thick In Proportionof 1:11 / 2:3 Using Colourpigment Including Scaffolding And Fourteen Days Curing Etc. Complete. 652 Providing Neeru Finish To Plastered Surfaces In All Positions Including Scaffolding And Curingetc. Complete. 653 Providing Flush Grooved Pointing With Cement Mortar 1:3 For Brick Work Including Scaffoldingand Curing Etc. Complete. 654 Providing Flush Grooved Pointing With Cement Mortar 1:3 For Stone Masonry Work Includingscaffolding And Curing Etc. Complete. 655 Providing Tuck Pointing With Cement Mortar 1:3 For Stone / Brick Masonry Includingscaffolding And Curing Etc. Complete. 656 Providingweatheredpointingwithcementmortar1:3Forstone / Brickmasonaryincludingscaffolding And Curing Etccomplete 657 Providingveepointingwithcementmortar1:3Forstone / Brickmasonryincludingscaffolding And Curing Etccomplete 658 Providingfinecement Finish 1.5Mmthickover Greenplaster Surfaceincludingscaffoldingcuringetc. Complete. 659 Labourchargesforprovidinggrooveinexternalplasterhavingwidthandspacedasdirectedbyengineer Incharge Etc. Complete. 660 Providingpatti / Band75mmwideonplasteredsurface 12Mm To15mm Thickinc.M.1:3Line Andlevel Including Neat Finishing Scaffolding Curing Etc. Complete. 661 Providing Patti / Band100mm Wide Onplasteredsurface 12Mm To 15 Mm Thick Inc.M. 1:3Line Andlevel Including Neat Finishing Scaffolding Curing Etc. Complete. 662 Providing Patti / Band150mm Wide Onplasteredsurface 12Mm To 15 Mm Thick Inc.M. 1:3Line Andlevel Including Neat Finishing Scaffolding Curing Etc. Complete. 663 Providing And Fixing Chicken Mesh Of 22 Gauge, With About 30 Cm. Width At The Junction Of R.C.Cmembers Andbrickwork, Ofapprovedqualityincludingfixing Meshinpositionby Necessary Drilling In Concrete / B B Masonry And Or Tying By Binding Wire Etccomplete 664 Providing And Applying Plasterwith Plasterofparisin6mm Thicknesstopreviouslyplastersurface Inall Position Including Preparing The Surface Scaffolding Etc. Complete. 665 Providing Andapplying Sprayplastermadewithfinelygradedmarbleandquartzin2mm Thickness In Two Coats Using Putty Knife Or Trowel To Newly Plaster Fairly Even Surface After Minimum 30 Days Gap In All Position Including Finishing The Surface Using Zero Number Sand Paper Or Fine Emry Paper Gently Level The Area Bymovingpaperinroundcirclesremovingthedustandcleanthesurfacewithdryclothandscaffoldingincluding All Material And Labour Etccomplete 666 Providing And Applyinglayingaggregateplaster In Granite / Marble Stones, As Decorative Finish To Givegranite / Marblelikeappearancetoconcrete, Brickor Block Surfacesin All Position Including Preparationofsurfacesmoothly, Evenlybyrackingofjointsincaseof Brick Or Block Work Including Backing Layer Of 12Mm Thickwithcementmortar 1:3With2%Integral Cementwater Proofing Compound, Roughening For Wall Keying Hardening And Drying The Surface For A Minimum Five Days Gaps Including Second Coat Of Cement Lime Mortar Into A Proportion 1:4 Preparing The Surface For Three Coat Of Marble Finish Plaster Giving A Thin Coat Of White Cement And Two Parts Of Course Calcite Powder, Applying The Mortar With Steel Float Onthesurfaceinproperevennessapplyingatcoatofwhitecementandlime Tosetasmoothfinish Then Applying Athincoatofslurry Made Ofwhite Cementandblackoxide Colourin Required Proportion By The Steel Float To Get Black Streaks On The Surface And Curing The Surface For Two Days Including All Materials And Labour Etc. Complete. 667 Providingandapplyingplaster / Wallpunningwithplasterofparis ( Withplasterofparis Material ) In10to13millimeterthicknessto Previously Plastered Surface / Or On Newly Brick Surface ( Excluding Rough Cast Plaster ) In All Position Including Preparing And Finishing The Surface Scaffolding Etc.Complete. 668 Providing And Applying Gypsum Plaster ( With Gypsum Material ) With Finishing With Gypsum Material In 10 To 13 Millimeter Thickness To Previously Plastered Surface / Or On Newly Brick Surface ( Excluding Rough Cast Plaster ) In All Position Including Preparing And Finishing The Surface Scaffolding Etc.Complete. 669 Providingandapplyingtextureplasterwithfinishingwithtexturematerial Ofapproved Makein 3 To 4 Millimeterthickness On Previously Plastered Surface, Including Plaster Groove 6Mmthicknessor Tape Grooves 35 To 45 Mm Thickness Or As Required, In All Positionincludingpreparingthesurface, Scaffolding Etc. Complete. 670 Removingtheexistingcementplasterofanythicknesswithoutcausingdustnuisanceandstackingthedebrisuptoadistanceof50metresorspreadinginthecompoundandcleaningthesiteetc. Complete. 671 Providing Andapplying Twocoats Ofwall Care Putty Onplastered Surface Andceiling And Walls To Prepare Surface Even And Smooth Of Approved Make, Etc Complete. 672 Providing Cementpatta / Bandof2.50Cm Widthoneitherside Ofedgesofplasterfordoors Andwindowsincluding Scaffoldingfinishingcuring Etc. Complete. 673 Providing Groove To Required Size At Specified Location As Directed By Engineer, At Junction Of Brick Masonry Wall And R.C.C Beams Or Column, At Junction Of Composite Masonry, Including Scaffolding, Finishing, Curingetccomplete 674 Providing And Laying Rough Shahabad Stone Flooring 25Mm To 30Mm Thick And Of Required Width In Plain / Diamond Pattern On A Bed Of 1:6 C.M. Including Cement Float, Striking Joints, Pointing In Cement Mortar 1:3Curing And Cleaningetc. Complete. 675 Providing And Laying Rough Shahabad Stone Flooring 40Mm.To 45 Mm. Thick And Of Required Width In Plain / Diamond Pattern On A Bed Of 1:6 C.M. Including Cement Float, Striking Joints, Pointing In Cement Mortar 1:3 Curing And Cleaning Etcetccomplete 676 Providing And Laying Rough Shahabad Stone Flooring 50Mm To 60Mm Thick And Of Required Width In Plain / Diamond Pattern On A Bed Of 1:6 C.M. Including Cement Float, Striking Joints, Pointing In Cement Mortar 1:3Curing And Cleaning Etcetccomplete 677 Providing And Laying Polished Shahabad Stone Flooring 25Mm To 30Mm Thick Andrequired Widthwidein Plain / Diamond Patternonabedof1:6C.M.Includingcementfloat, Filling Joints, With Neat Cementslurrycuringpolishing And Cleaning Etc. Complete. 678 Providing And Laying Polished Tandur Stone Flooring 25Mm To 30Mm Thick Required Width In Plain / Diamond Pattern On A Bed Of 1:6 C.M. Including Cement Float, Filling Joints With Neat Cement Slurry, Curing, Polishingand Cleaning Etc. Complete. 679 Providing And Laying Machine Cut Machine Polished Kota Stone Flooring 25Mm To 30Mm Thick Andrequired Width In Plain / Diamond Patternonbed Of1:6 C.M. Including Cement Float, Filling Joints Withneatcement Slurrycuringpolishing And Cleaningetc. Complete. 680 Providingandlayinghandcutpolishedkotahstoneflooring25mmto30mmthickand30cmwidein Plain / Diamondpatternonabedof1:6C.M.Including Cementfloat, Fillingjointswithneatcementslurry, Curingpolishing And Cleaningetc. Complete. 681 Providing And Laying Polished Hand Cut Kotah Stone Flooring 25Mm To 30Mm Thick And 45Cm To 55Cm Wide Inplain / Diamondpatternonabedof1:6C.M.Including Cementfloat, Fillingjointswithneatcementslurry, Curingpolishing And Cleaning Complete 682 Providing And Laying Cement Concrete Flooring 40 Mm Thick With M15 Cement Concrete Laid To Proper Level And Slope In Alternate Bays Including Compaction, Filling Joints, Marking Lines To Givetheappearanceoftiles Of30cmx30cmorothersizelaiddiagonally / Squareetc Finishing Smooth ( With Extra Cement ) In Any Colour As Directed And Curing Etc.Complete.With Crushed Sand Vsi Grade 683 Providing And Laying Cement Concrete Flooring 40 Mm Thick With M15 Cement Concrete Laid To Proper Level And Slope In Alternate Bays Including Compaction, Filling Joints, Marking Lines To Givetheappearanceoftiles Of30cmx30cmorothersizelaiddiagonally / Squareetc Finishing Smooth ( With Extra Cement ) In Any Colour As Directed And Curing Etc. Complete. With Crushed Sand. 684 Providing And Laying Cement Concrete Flooring 40Mm Thick With M20 Cement Concrete Laid To Proper Level And Slopeinalternatebays, Includingcompaction, Fillingjoints, Markinglinestogiveappearanceof Tiles Of 30Cm X30cm Or Othersize Laiddiagonally / Square Etc.Finishing Smooth ( With Extra Cement ) In Any Colour As Directed And Curing Etc. Complete. With Crushed Sand Vsi Grade 685 Providing And Laying Cement Concrete Flooring 40Mm Thick With M20 Cement Concrete Laid To Proper Level And Slopeinalternatebays, Includingcompaction, Fillingjoints, Markinglinestogiveappearanceof Tiles Of 30Cm X30cm Or Othersize Laiddiagonally / Square Etc.Finishing Smooth ( With Extra Cement ) In Any Colour As Directed And Curing Etc. Complete. With Crushed Sand Vsi Grade 686 Providing And Laying Cement Concrete Flooring 50 Mm Thick With M15 Cement Concrete Laid To Proper Level And Slope In Alternate Bays Including Compaction Filling Joints, Marking Lines To Give The Appearance Of Tiles Of 30Cm X 30Cm Or Other Size Laid Diagonally / Square Etc Finishing Smooth ( With Extra Cement ) In Any Colour As Directed And Curing Etc. Complete.With Crushed Sand Vsi Grade 687 Providing And Laying Cement Concrete Flooring 50 Mm Thick With M15 Cement Concrete Laid To Proper Level And Slope In Alternate Bays Including Compaction Filling Joints, Marking Lines To Give The Appearance Of Tiles Of 30Cm X 30Cm Or Other Size Laid Diagonally / Square Etc Finishing Smooth ( With Extra Cement ) In Any Colour Asdirected And Curing Etc. Complete. With Crushed Sand. 688 Providing And Laying Cement Concrete Flooring 50Mm Thick With M20 Cement Concrete Laid To Proper Level And Slope Inalternate Bays Including Compaction, Filling Joints, Marking Lines To Give The Appearance Of Tiles Of 30Cm X 30Cm Or Other Size Laid Diagonally / Square Etc. Finishing Smooth ( With Extra Cement ) In Any Colour As Directed And Curing Etc. Complete.With Crushed Sand Vsi Grade 689 Providing And Laying Cement Concrete Flooring 50Mm Thick With M20 Cement Concrete Laid To Proper Level And Slope Inalternate Bays Including Compaction, Filling Joints, Marking Lines To Give The Appearance Of Tiles Of 30Cm X 30Cm Or Other Size Laid Diagonally / Square Etc. Finishing Smooth ( With Extra Cement ) In Any Colour Asdi Td Di T Ltwith C Hd Sd 690 Providing And Laying Machine Cut Machine Polished Shahabad Stone Slabs 20 To 25Mm Thick For Treads And Risersofstepsandstaircases, Withroundednosing Forthetreadsonabedof1:4Cementmortarincluding Cement Float, Filling Joints With Neat Cement Slurry, Curing, Polishing And Cleaning Etc. Complete. 691 Providingandlayingmachinecutmachinepolishedmachinecutkotastoneslabs20to25mm Thickfor Treads Andrisers Of Steps Andstaircases, Withroundednosing For The Treads On A Bed Of 1:4 Cement Mortar Including Cement Float, Filling Joints With Neat Cement Slurry, Curing, Polishing And Cleaning Etc. Complete. 692 Providing Sills Of Polished Kota Stone 25 Mm To 30Mm Thick, On A Bed Of 1:4 Cement Mortarincluding Cement Float, Filling Joints With Slurry, Curing, Moulding Edges, Polishing Andcleaningetc. Complete. 693 Providing Sills Of Polished Kadappa Stone25mmto 30Mmthick, On A Bed Of 1:4 Cementmortar Includingcementfloat, Filling Jointswithslurry, Curingpolishingandcleaningetc.Complete. 694 Providingsillsofrequiredmaterial20mmto25mmthick, Onabedofcementmortar1:4 Including Cement Float, Filling Joints With Neat Cement Slurry, Curing, Polishing, Mouldingedges, Cleaning Complete.A ) Marble Other Thanhite Makrana 695 Providingsillsofrequiredmaterial20mmto25mmthick, Onabedofcementmortar1:4 Including Cement Float, Filling Joints With Neat Cement Slurry, Curing, Moulding Edges, Polishing, Cleaningcomplete.B ) Granite 696 Providingand Fixingblack Kadappa Stoneas Shelves25mm. Thick Machine Polished, Extending The Polish Upto 20 Cm Width On Lowerside, Rounding Corners, Laying In Positionjointingwithbeddingcement Mortar 1:4 Roportion Curing Etc Etc. Complete. 697 Providing And Laying Matt Finish Ceramic Tiles Of Having Size 30 Cm X 30 Cm Confirming To I.S.15622 / 2006 ( Groupdii-A ) And7to8mm Thickforflooringinrequiredpositionlaidonabedof1:4Cementmortar Including Cement Float, Filling Joint With White / Colour Cement Slurry Cleaning Curing Etc. Complete. 698 Providingandlayingceramictilesof Havingsize30cm.X30cm.Andconfirmingto Correspondingi.S. For Dado And Skirting In Required Position With Readymade Adhesive Mortar Of Approved Quality On Plaster Of 1:2 Cement Mortar Including Joint Filling With White / Colour Cement Slurry Cleaning Curing Etc. Complete. 699 Providing And Laying Ceramic Tileshaving Size 30 Cm. X 45 Cm. Confirming To Correspondingi.S. For Dado And Skirting In Required Position With Readymade Adhesive Mortar Of Approved Quality On Plaster Of 1:2 Cement Mortar Including Joint Filling With White / Colour Cement Slurry Cleaning Curing Etc. Complete. 700 Providing And Laying Ceramic Tiles Having Size 30 Cm. X 60 Cm. Confirming To Correspondingi.S.For Dado And Skirting In Required Position With Readymade Adhesive Mortar Of Approved Quality On Plaster Of 1:2 Cement Mortar Including Joint Filling With White / Colour Cement Slurry Cleaning Curing Etc. Complete. 701 Providingmirrorpolishingtokotastoneincludingusingallnecessarystonesandequipmentscleaning, Washingetc. Complete. For Flooring 702 Providingmirrorpolishingtokotastoneincludingusingallnecessarystonesandequipmentscleaning, Washingetc. Complete. For Skirting 703 Providingandlayinginsitucementconcretem20withtremixtreatmentfor100mm Thicknessfor Flooringwithgroovecuttingof4mmwideand20mmdeepwithnecessaryrefilling With Bitumenetc. Complete. 704 Providingandlayinginsitucementconcretem30withtremixtreatmentfor200mm Thicknessfor Flooringwithgroovecuttingof4mmwideand20mmdeepwithnecessary Refilling With Bitumenetc.Complete. 705 Providing 25 Mm To 30 Mm Thick Partition Of Polished Black Kadappa Stone Slab Of Approved Quality Including Giving Required Size And Shape Etc. Fixing In Cement Mortar 1:3 Curing And Cement Etc. Complete. A ) One Sidepolish 706 Providing 25 Mm To 30 Mm Thick Partition Of Polished Black Kadappa Stone Slab Of Approved Quality Includinggiving Required Size And Shape Etc. Fixing In Cement Mortar 1:3 Curing And Cement Etc. Complete. B ) Both Side Polish 707 Providing And Laying In Position Flooring Of Telephone Black / Amba White / Cat Bary Brown / Rubyred / Oceanbrowngranite Stone Ofapprovedshade Andsize 18Mm To 20Mm Thickonbed1:6Cementmortar Including Cement Floats Striking Joints, Pointing In C.M. 1:3 Curing And Cleaning Etc. Complete. 708 Providing And Fixing Machine Cut Machine Polished 18 Mm To 20 Mm Thick Telephone Black / Amba White / Cat Bary Brown / Rbi Red / Ocean Brown Granite Stone For Treads And Risers Of Steps And Staircases Of Approved Colour And Shade Withfullmoulding And Three Grooved Line Forthetreadsonbedof1:4Cementmortar Includingfloatfilling Jointswithneatcement Slurry Curing Polishing And Cleaningetc. Complete. 709 Providingand Fixingmachine Cut Mirror Polished 18 Mm To 20 Mm Thicktelephone Black Granite / Amba White / Cat Bary Brown / Rbi Red / Ocean Brown Granite Stone Partition With Full Moulding The Edgesetc.Complete . Both Side Polish 710 Providing And Fixing Machine Cut Mirror Polished 18 Mm To 20 Mm Thick Telephone Black / Ambawhite / Catbarybrown / Rbired / Oceanbrown Granitestonepartition With Full Moulding The Edgesetc.Complete. One Side Polish 711 Providing And Preparing Kitchen Otta Up To 75 Cm Width, Made Up From 30 Mm Thick And 75 Cm High Vertical Support For Kadppa At 1 M. C / C Of 25 Mm Thick Both Side Polished Kadappa Middle Shelf And Bottom Of 20 Mm Thickone Side Polishedkadappawithfaciapattiof20x50mm Kadappa Including All Material Labour Cuttingfixingwithcementmortarandaraldite Curing Polished And Cleaningetc. Complete. 712 Providing And Fixing 1.5 Mm Thick Polyvenyl Venyl Chloride Flooring Including Leveling Thebase With White Cement Including Pasting With Appropriate Material Cleaning The Surface Etc. Complete 713 Providing And Laying Vitrified Mirror / Glossy Finish Tiles Decorative Typehaving Size 590 Mm To 605 Mm X 590Mm To 605Mm Of 8To 10Mm Thickness Andconfirming To Is. 15622-2006 ( Groupbla ) Of Approved Make, Shade And Pattern For Flooring In Required Position Laid On A Bed Of1:4Cementmortarincludingneat Cementfloat, Fillingjoints, Curingandclearing Etc. Complete. 714 Providing And Laying Vitrified Mirror / Glossy Finish Tiles Having Size 590 Mm To 605 Mm X 590 Mm To 605 Mm Of 8 To 10 Mm Thickness And Confirming To Is. 15622-2006 ( Group Bla ) Of Approved Make, Shade And Patternfordadoandskirtinginrequiredpositionfixedin1:4Cementmortarincludingneatcementfloat, Fillin Jointscurin And Clearinetc. Comlete 715 Providing And Laying Vitrified Matt Fininsh Tileshaving Size 590 Mm To 605 Mm X To 605 Mm Of8to10mm Thickness And Confirming Is. 15622-2006 ( Group Bla ) Of Approved Make, Shade And Pattern For Flooring In Required Position Laid On A Bed Of 1:4 Cement Morarincludingneatcementfloat, Fillingjointscuring And Cleaning Etc. Complete. 716 Providing And Laying Vitrified Matt Finish Tileshaving Size 590 Mm To 605 Mm X To 605 Mm Of8to10mm Thicknessandconfirmingis.15622-2006 ( Groupbla ) Ofapprovedmake, Shadeandpatternfordado Andskirtinginrequiredpositionfixedin1:4Cementmortar Including Neat Cement Float, Filling Joints, Curing And Cleaning Etccomplete 717 Providing And Laying Vitrified Rustic Matt Stone Finish Tileshaving Size 590 Mm To 605 Mm X 590 Mm To 605 Mm Of 8 To 10Mm Thickness And Confirming To Is. 15622-2006 ( Group Bla ) Of Approvedmake, Shadeand Patternforflooringinrequiredpositionlaid Onabedof1:4 Cement Mortar Including Neat Cement Float, Filling Jointscuring And Cleaning Etccomplete 718 Providing And Laying Vitrified Rustic Matt Stone Finish Tileshaving Size 590 Mm To 605 Mm X 590 Mm To 605 Mm To 8 To 10Mm Thickness And Confirming To Is. 15622-2006 ( Group Bla ) Of Approvedmake, Shadeand Pattern For Dado And Skirting In Required Position Fixed In 1:4Cementmortarincludingneatcementfloatfilling Jointscring And Cleaningetccomplete 719 Providing And Laying Vitrified Stone Effect Finish Tileshaving Size 590 To 605 Mm X 590To 605 Mm Of 8 To 10 Mmthicknessandconfirmingtois.15622-2006 ( Groupbla ) Ofapprovedmake, Shadeandpatternfor Flooring In Required Position Laid On A Bed Of 1:4 Cement Mortar Including Required Position Laid On A Bed Of 1:4 Cement Mortar Including Neat Cement Float, Filling Joints, Curing And Cleaning Etc.Complete 720 Providing And Laying Vitrified Stone Effect Finish Tileshaving Size 590 To 605 Mm X 590To 605 Mm Of 8 To 10 Mm Thickness And Confirming To Is. 15622-2006 ( Group Bla ) Of Approved Make, Shade And Pattern For Dado And Skirting In Required Position Fixed In1:4 Cement Mortar Including Requiredpositionlaidonabedof 1:4Cementmortarincluding Neatcementfloat, Filling Joints, Curign And Cleaningetc. Complete. 721 Providingandfixinggreenmarbleof18to20mmthickfordoorframe / Dado / Window Boxing Etc. Onc.M.1:6Includingfillingjointswithpolymerbase Fillernosing / Moulding Thesharpedgeswherevernecessarycuring Etc. Complete. 722 Providingand Fixing Heavyduty Inter Locking Concretegrey Pavingblocks Of 60 Mm Thicknessofhaving A Strength Of 300 Kilogram / Sq.Cm. Of Approvedquality Andshape Ona Bed Of Crushed Sand Of 25 To 30 Mm Thick Including Skirting Joints And Cleaninetc. Complete. 723 Providingand Fixing Heavyduty Inter Locking Concretegrey Pavingblocks Of 80 Mm Thicknessof Having A Strength Of 300 Kilogram / Sq.Cm. Of Approvedquality Andshape Ona Bed Of Crushed Sand Of 25 To30 Mm Thick Including Skirting Joints And Cleaningetc. Complete. 724 Providingandfixingheavydutyinterlockingconcretecolouredpavingblocksof60mm Thickness Of Having A Strength Of 300 Kilogram / Sq.Cm. Of Approvedquality Andshape Ona Bed Of Crushed Sand Of 25 To30 Mm Thick Including Skirting Joints And Cleaning Etc. Complete 725 Providingandfixingheavydutyinterlockingconcretecolouredpavingblocksof80mm Thickness Of Having A Strength Of 300 Kilogram / Sq.Cm. Of Approvedquality Andshape Ona Bed Of Crushed Sand Of 25 To30 Mm Thick Including Skirting Joints And Cleaning Etc Complete 726 Providing And Fixing Heavy Duty Inter Locking Concrete Rubber Mould Glossypaving Blocksof60millimeterthicknessofhavingastrengthof400kilogram / Sq.Mofapprovedqualityand Shapeonabedofcrushedsandof25to30millimeterthickincludingstrikingjointsandcleaning Etc.Lt ( I 100% C Hd D ) 727 Providingandfixingheavydutyinterlockingconcreterubbermouldglossypavingblocksof80mm Thickness Of Having A Strength Of 400 Kilogram / Sq.Cm. Of Approved Quality And Shape On A Bedof Crushed Sand Of 25 To 30 Mm Thick Including Skirting Jointsandcleaning Etc. Complete. ( Using 100% Crushed Sand ) 728 Providingandfixingheavydutyinterlockingconcretecolouredpavingblocksof40mm Thickness Of Having A Strength Of 200 Kilogram / Sq.Cm. Of Approvedquality Andshape Ona Bed Of Crushed Sand Of 25 To30 Mm Thick Including Skirting Joints And Cleaning Etc.Complete. 729 Providing Leather Finished Polishing To Granite Stone Slab By Continuous Grinding In 4 Coats Of Different Bits To Receive Rough And Matt Finish Including Buffing Process Before Laying And Fixingofstoneasperdrawing Anddesign, Includingcleaning, Washingandfinishingetc. Complete. 730 Providing Leather Finished Polishing Tokota / Marble / Shahabad / Kadappa Stoneslab Bycontinuous Grindingin4coatsofdifferentbitstoreceiverough And Mattyfinishincludingbuffing Process Before Layingand Fixingofstoneasperdrawinganddesign, Including Cleaning, Washing And Finishingetc.Complete 731 Providing And Layingvitrified Mirror / Glossy Finishhaving Decorativetypeof Size590millimeterto 605 Millimeter X 590 Millimeter To 605 Millimeter Of 8 To 10 Millimeter Thickness ( On A Existing Flooring ) With Bondingchemicalandconfirming Tois15622-2006 ( Groupbla ) Ofapprovedmake Shadeandpatternfor Flooringinrequiredpositionlaidonabedofbondingchemicalfillingjointscuringandcleaningetc.Lt 732 Providing And Laying Vitrified Matt Finishhaving Decorative Type Of Size 600 Millimeter X 600 Millimeter Of 8 To 10 Millimeter Thickness ( On A Existing Flooring ) With Bonding Chemical Andconfirmingtois15622- 2006 ( Group Bla ) Ofapproved Makeshadeand Patternfor Flooringin Requiredposition Laidon A Bedofbondingchemicalfillingjointscuringand Cleaning Etc .Complete. 733 Providing And Laying Vitrified Matt Finishhaving Decorative Type Of Size 1000 Millimeter X 1000 Millimeter Of 8 To 10 Millimeter Thickness ( On A Existing Flooring ) With Bonding Chemical Andconfirmingtois15622- 2006 ( Group Bla ) Ofapproved Makeshadeand Patternfor Flooringin Requiredposition Laidon A Bedofbondingchemicalfillingjointscuringand Cleaning Etc .Complete. 734 Providingandlayingvitrifiedrusticmattstonefinish Havingdecorativetypetilesofsize600 Millimeterx600 Millimeter Of 8 To 10 Millimeter Thickness ( On A Existing Flooring ) Withbondingchemical And Confirming To Is 15622-2006 ( Group Bla ) Of Approved Makeshadeandpatternforflooringin Required Position Laid On A Bed Of Bonding Chemical Filling Joints Curing And Cleaning Etc. Complete. 735 Providing And Laying Vitrified Stone Effect Finishhaving Decorative Type Tiles Of Size 590Millimeter To605 Millimeter X 590 Millimeter To605 Millimeter Of 8 To10 Millimeter Thickness ( On A Existing Flooring ) Withbonding Chemical And Confirming To Is 15622-2006 ( Group Bla ) Of Approved Make Shade And Pattern For Flooring In Required Position Laid On A Bed Of Bonding Chemical Filling Joints Curing And Cleaningt Lt 736 Providingandlayingchequeredtilesof Approvedqualityofsize30cmx30 Cm, Confirmingto Corresponding I.S. For Flooring In Required Position Laid On A Bed Of 1:4 Cement Mortarincludingcement Floatfilling Joint With Cement Slurry Cleaning Curing Etc. Complete. 737 Providing And Laying Antiskid Ceramic Tiles Of Approved Qualityof Size 30 Cm X 30 Cm And Confirming To Is 15622-2006 ( Group-Biia ) Forantiskidflooringinrequiredpositionlaidonabedof1:4Cementmortar Including Cement Float, Filling Joint With Cement Slurry Cleaning Curing Etc. Complete. 738 Providing And Laying Telephone Black / Amba White / Cadburybrown / Ruby Red / Oceanbrown Granite Stone Of 18 To 20 Mm Thick For Door Frame / Dado / Window Boxing Etc. On C.M. 1:6 Including Filling Joints With Polymer Base Filler Nosing / Moulding The Sharp Edges Wherever Necessary, Curing, Etc. Complete. 739 Providing And Layingpolished Kota Stoneflooringwith Hand-Cut Polished Kota Stones25mmto 30Mm Thick And Required Width In Plain / Diamond Pattern On Bed Of 1:6 Cementmortar Including Cement Float, Filling Joints With Neat Cement Slurry, Curing, Cleaning Andmirror Polishing Etc. Completenote-Waterabsorptionforkota Stoneshouldnotexceed 0.05%. ( Item To Be Used With Priori I F S Itdi Ei ) 740 Providing, Layingand Fixingexteriorgradefibrillingfibrereinforcementheavydutydesignercement Concrete Tilesforflooring Ofapprovedcolour Anddesign 22+ / -2Mm Thickbayer Colourpigmentedas Peris..1237-1980Havingcompressivestrengthmorethan500 Kilogram / Sq.Cmreaffirmedin2006, Having Wert Transvrse Strenghth Of 3.5 / Mm 2, Waterabsorptionlessthan10%Abrasion / Wear Resistance Less Than 2 Mm , Skid Resistance More Than25.0 ( Astm:E303 ) And No Fading As Per Din - 51094 Of Size 300 X 300In Plan / Designed Pattern On A Bed Of1:4Cementmortarincludingcementfloat, Fillingjointswithneatcementslurry, Curing, Polishingand Cleaning Etc. Complete. For Flooring. 741 Providing, Laying And Fixing Exterior Grade Fibrilling Fibre Reinforcement Heavy Duty Designer Cement Concrete Tiles Forsteps And Dado Of Approved Colour And Design 22 + / -2 Mm Thick Bayercolourpigmentedasperis 1237-1980Reaffirmedin2006, Havingwerttransvrse Strenghth Of 3.5 / Mm 2, Water Absorption Less Than 10 % Abrasion / Wear Resistance Less Than 2 Mm , Skid Resistance More Than 25.0 ( Astm:E303 ) And No Fading As Per Din - 51094 In Plan / Designed Pattern On A Bed Of 1:4 Cement Mortar Including Cement Float, Filling Joints With Neat Cement Slurry , Curing, Polished And Cleaning Etc. Complete. For Steps, And Dado 742 Machine Polishing To Cement / Marble Mosaic Tiled Flooring Or Any Other Type Of Flooringincluding Cleaning, Washing, Etc. Complete. 743 Hand Polishing To Dado, Skirting Including Cleaning, Washing Etc. Complete. 744 Providing Wax Polishing To Floors And Dado, Preparing The Surface, Scaffolding Etc. Complete. 745 Providing Andfixing In Required Positionskirting Or Dado Of Polishedkotahstone Slab25 Mm To 30Mmthick Fixed On Base On Plaster Of Cement Mortar 1:4 Including Cement Float, Filling Joints Withcement Slurrycuring Rubbingpolishing And Cleaning Complete 746 Providing And Applying Boiled Linseed Oil In Onecoat, To The New Wood Work, Including Knotting, Preparing The Surfacescaffolding Etc. Complete As Directed. 747 Providingand Applyingboiled Linseed Oil In Twocoatstothenew Wood Work, Including Knotting, Preparing The Surfacescaffolding Etc. Complete As Directed. 748 Providing And Applying Wax Polish To The New Wood Work Including Knotting, Preparing Thesurfacescaffolding Etc. Complete As Directed. 749 Providingandapplyingwaxpolishtotheoldwoodworkincludingknotting, Preparingthesurface, Scaffolding Etc. Complete As Directed. 750 Providing And Applying French Polish For Required Finish On Previously Polished Woodincludingknottingpreparing The Surfacesscaffolding Etc. Complete As Directed 751 Providingand Applyingfrench Polish To New Wood Work, For Required Finishing Including.Knotting, Preparing The Surfacesscaffolding Etc. Complete As Directed. 752 Providingandapplyingvarnishin Onecoat Onpreviouslyvarnished Wood Workincluding Knotting, Preparing The Surfacescrappingscaffoldingetc. Complete. 753 Providingandapplyingvarnishintwocoatsonnewwoodworkincludingknotting, Preparing The Surfacescaffolding Etc. Complete. 754 Providing And Applying Melamine Polish Of Required Finish To The Wood Work By Spraymachine Includingknottingandpreparingtheevensurfacebyscraping, Applyingfrench Polish , Scaffolding If Required Etc. Complete.Nt Th K T Btdil F S Itdi Ei Ill B 755 Providingandapplyingcoaltarinonecoatonpreviouslycoaltarredwoodincludingpreparing The Surface, Scaffolding Etc.Complete. ( Coaltar Shallbe Minimum 300 Gramsper Square Metre. ) 756 Providing And Applying Coal Tar In Two Coats On New Wood Work Including Preparing Thesurface, Scaffolding Etc. Complete. ( Coal Tar Shall Be Minimum 500 Grams Per Square Metre. ) 757 Providing And Applying Two Coats Of Lead / Zinc Base Oil Paint / Bituminous Paint Of Approved Colourandshade Tonewwoodworkandfiberboardsincludingpreparingthesurface, Knotting, Scaffolding If Necessary, Excluding Primer Coat Etc. Complete. 758 Providing Andapplying One Coatoflead / Zincbase Oilpaint / Bituminouspaintofapproved Colour And Shadetooldwoodworkpreviouslypaintedandfiberboardsincludingifnecessaryscaffolding, Preparingsurface Excluding Primer Coat Etccomplete 759 Providing And Applying Two Coats Of Lead / Zinc Base Oil Paint / Bituminious Paint Of Approved Colour And Shade To Old Wood Work And Fiber Boards Previously Painted Including If Necessary Scaffolding, Preparing The Surfaceexcluding Priming Coat Etc Complete 760 Providing And Applying Two Coats Of Lead / Zinc Base Oil Paint / Bituminious Paint Of Approved Colourtonew Structural Steel Work And Iron Work In Buildings Including Scaffolding Ifnecessary, Cleaningandpreparing The Surface Etc.Complete. ( Excluding Primer Coat ) . 761 Providingandapplyingonecoatofaluminiumpaintofapprovedmaketonewstructuralsteelwork In Building And Workshop Including Scaffolding If Necessary, Cleaning And Preparing Surface ( Excludingprimer Coat ) Etc. Complete. 762 Providingandapplying2coatsofalluminiumpaintofapprovedmaketonewstructuralsteelworkinbuildingsandworkshopsincluding Scaffolding Ifnecessary, Cleaning Andpreparing The Surface ( Excluding Primer Coat ) Etc.Complete. 763 Providing Andapplying Two Coats Of Synthetic Enamel Paint Of Approved Colour To New / Old Structural Steel Workandwoodworkinbuildings, Includingscaffoldingifnecessary, Cleaningandpreparingthesurface ( Excluding Primer Coat ) Etc. Complete. 764 Providing And Applying One Coat Of Flat Oil Paint Of Approved Colour To The Old Structural Steel Workandironworkpreviouslypaintedinbuildingincludingscaffolding, Ifnecessary, Cleaning And Preparing Surface ( Excluding Primer Coat ) Etccomplete 765 Providing And Applying Two Coats Of Flat Oil Paint Of Approved Colour To The Old Structural Steel Workandironwork Previously Painted In Building Including Scaffolding, If Necessary, Cleaningandpreparingthe Surface ( Excluding Primer Coat ) Etccomplete 766 Providing And Applying One Coat Of Flat Oil Paint Of Approved Colour And Shade To Internal / Externalplastered Surfacesincludingscaffoldingifnecessary, Cleaningandpreparingthe Surface ( Excluding Primer Coat ) Etc. Complete. 767 Providingandapplyingtwocoats ( Exteriorquality ) Offlatoilpaintofapprovedcolourandshadetotheplasteredsurfaceinbuildingsandworkshopsincludingscaffoldingifnecessary, Cleaningthesurfaceand Preparing Surface Etc. Complete. ( Excluding Primer Coat ) 768 Providing And Applying Two Coats Of Flat Oil Paint Of Approved Colour And Shade To Internal / Externalplastered Surfacesincludingscaffoldingifnecessary, Cleaningandpreparingthe Surface ( Excluding Primer Coat ) Etc. Complete. 769 Providingandapplyingtwocoatsofwaterproofcementpaintofapprovedmanufactureandofapproved Colourtotheplasteredsurfacesincludingscaffoldingifnecessary, Cleaningandpreparingthesurface, Watering For Two Days Etc.Complete. 770 Providingandapplyingtwocoatsofwaterproofcementpaintofapprovedmanufactureandofapproved Colourtoold Plasteredsurfacesincludingscaffoldingifnecessary, Cleaningandpreparingthesurface, Watering For Two Days Etc Complete 771 Providing Andapplying Three Coatsof Waterproof Cementpaint Ofapprovedmanufacture Andofapproved Colourto Newplasteredsurfacesincludingscaffoldingifnecessary, Cleaningandpreparingthesurface, Watering For Two Days Etc. Complete. 772 Providing Andapplying Three Coatsof Waterproof Cementpaint Ofapprovedmanufacture Andofapprovedcolourtoold Plasteredsurfacesincludingscaffoldingifnecessary, Cleaningandpreparingthesurface, Watering For Two Days Etc. Complete. 773 Removing Old Paint From Steel Andother Metal Surfaces Andmaking The Surfaces Even With Hand Scrapping, Scaffolding Etc. Complete. 774 Providingandapplyingprimingcoatovernewwoodandwoodbasedsurfaces, Including Preparing The Surfacebythoroughlycleaningoil, Grease, Dirtandotherforeignmatter, Sandpaperingandknotting, Scaffolding Etc. Complete. 775 Providing Andapplying Priming Coat Over New / Oldsteel Andothermetal Surfacesincluding Preparingthe Surface By Thoroughly Cleaning Oil, Grease, Dirt And Other Foreign Matter Andscoured With Wire Brushes, Finesteelwool, Scrappersandsandpaper, Scaffoldingetc.Complete. 776 Providing And Applying Priming Coat On Concrete / Masonary / Asbestos Cement Plasteredsurfaces Includingscaffoldingifnecessary, Preparingthesurfacebythoroughlycleaningoil, Grease, Dirtandotherforeign Matter And Sand Papering As Required Etc. Complete. 777 Providing And Applying One Coat Of Seal Cement Primer Of Approved Manufacture And Shedincluding Scaffolding Preparing The Surface By Cleaning Dirt And Other Foreign Matters, Scrappingifnecessaryincluding Scaffolding Etc. Complete. 778 Providing And Applying Pearl / Luster Finish Paint Of Approved Colour And Shade To The Existing Plaster Surface Including Scaffolding, Preparing The Surface, Applying The Acrylic Wall Putti Etc.Complete. 779 Providing And Applying Two Coats Of Textured Synthetic Paint Of Approved Shade And Quality Andonecoatof Primerbeforeapplyingtexturedpaintincludingscaffoldingifnecessary Preparing Surface By Thoroughly Cleaning Oil, Grease, Dirt And Other Materials As Required, Etc. Complete. 780 Providingand Applyingtwocoatsof Exterioracraylicemulsion Paintconfirmingto Corresponding I.S. Of Approved Manufacture And Of Approved Colour To The Plastered Surfaces Includingcleaning, Preparingthe Plastersurface, Applyingprimercoat, Scaffoldingif Necessary , And Watering The Surface For Two Days Etccomplete 781 Providing And Applying Two Coats Of Exteriorweather Shield Paint Of Approved Manufacture Andofapproved Colourtotheplasteredsurfacesincludingcleaning, Preparingtheplaster Surface , Applying Primer Coat, Scaffolding If Necessary, And Watering The Surface For Two Days Etccomplete.Note: Foritem Number 15 To 18 Prior Approval Of Superintending Engineer Will Be Necessary 782 Providing And Applying External Raincoat Painting With Crack Fillingacrylic Polymer Basedchemical Compoundcoatingtotheexternalsurfaceofwallstopreventwaterseepageinthemasonrywallsduring Monsoonaddedwithrequiredshadesteinertogiverequiredshadetothesurfaceintwocoats.Including Providing Three Coatofpriming Ofpolymerbaseprimerincludingpreparing Surfacescrapping Theexisting Looseoldpaint, Removinglooseparticlesofsand On The Surface Opening And Cleaning The Cracks Developed In Theexternal Plaster, Removinglooseparticlesbychiseling, Fillingcracksbychemicals Compoundofapproved Makewithproperpenetrationetc.Coatingofraincoatwiththehelpofbrush Andasper Instructions Andspecificationgivenby Manufacturerandwithinstructionfrom Engineer In- Charge. Work Shall Be Executed By Certified Applicator Only And Covering Gurantee Of 3 Years On Court Stamp Paper Of Rs. 500 / - And Necessary Testing Etc. Complete. 783 Providingandapplyingwhite-Washinonecoatonold / Newplasteredormasonrysurfacesandasbestos Cement Sheets Including Scaffolding And Preparing The Surface By Brushing And Brooming Downetc. Complete. 784 Providing Andapplying White-Washintwocoatsonold / Newplasteredormasonrysurfacesandasbestos Cement Sheets Including Scaffolding And Preparing The Surface By Brushing And Brooming Down Etc. Complete. 785 Providingandapplyingcolour-Washofapprovedcolourandshadeinonecoattonewsurfaceincluding Scaffolding, Brushing And Brooming Down ( Excluding Base Coats Of White Wash ) Etc.Complete 786 Providing And Applying Colour-Wash Of Approved Colour And Shade In Two Coats To Newsurface Includingscaffolding, Brushingandbroomingdown ( Excludingbasecoatofwhite-Wash ) Etc. Complete. 787 Providing And Applying Colour-Wash Of Approved Colour And Shade In One Coat To Old Surfaces Which Are To Berecolouredincludingscaffolding, Brushingandbroomingdown. ( Excludingbasecoatofwhitewash ) Etc. Complete. 788 Providingandapplyingcolour-Washofapprovedcolourandshadeintwocoatstoold Surfaceswhich Aretoberecolouredincludingscaffolding, Brushingandbroomingdown. ( Excluding Base Coat Of White-Wash ) Etc. Complete. 789 Providing And Applying Washable Powder Distemper Of Approved Colour And Shade To Old And New Surfaces In One Coat Including Scaffolding, Preparing The Surfaces ( Excluding The Priming Coat ) Etc. Complete. 790 Providing And Applying Washable Powder Distemper Of Approved Colour And Shade To Old And New Surfaces In Two Coats Including Scaffolding, Preparing The Surfaces. ( Excluding The Primer Coat ) Etc .Complete. 791 Providingandapplyingwashableoil-Bounddistemperofapproved Colourand Shadetooldand New Surfaces In One Coat Including Scaffolding, Preparing The Surfaces. ( Excluding Theprimercoat. ) Etc.Complete 792 Providingandapplyingwashableoil-Bounddistemperofapproved Colourand Shadetooldand New Surfaces In Two Coats Including Scaffolding, Preparing The Surfaces. ( Excluding The Primer Coat. ) Etc. Complete. 793 Providing And Applying Plastic Emulsion Paint Of Approved Quality, Colour And Shade To Old Andnewsurfaces Intwocoatsincludingscaffolding, Preparingthesurface. ( Excludingthe Primer Coat ) Etc. Complete. 794 Providing And Applying Plastic Emulsion Paint Of Approved Quality, Colour And Shade To Old Surface In Three Coats Including Scaffolding, Preparing The Surface. ( Excluding Primer Coat ) Etc. Complete. 795 Providing And Applying Plastic Emulsion Paint Of Approved Quality, Colour And Shade Tonew Surface In Three Coats Including Scaffolding, Preparing The Surface. ( Excluding Primer Coat ) Etc. Complete. 796 Washing And Cleaning Of Decorated Wall Surfaces With Soap, Soda And Water Etc. Complete. 797 Providing And Applying Plastic Emulsion Paint Of Approved Quality, Colour And Shade To Old And New Surfaces In Single Coat Including Scaffolding, Preparing The Surface. ( Excluding The Primer Coat ) Etc. Complete. 798 Scrapping The Oldplasteredinternalsurface Withsandpaperandcoatingthe Entiresurface With Mixtureof Whiting Or Glue And Linseed Oil Including Scaffolding Etc. Complete As Directed. 799 Providing And Applying Interior Wall Finish Luster Of Approved Make On Internal Wall Surface As Detailed Below Scrapping The Surface With Emery Paper Andwipe Clean Wall Primer With Brushwithmineralturpentine Withbrush8to10%Andoil15to20%Withrollerand Allowingtodryforaperiod6to8hours. Wallputtywithappropriateproportionofwater Allowing To Dry Forperiod4to 6Hours.Scrapping With Emerypaper180andwipe Clean. Applyingwall Primer Withbrushwithmineral Turpentine 8 To 10% And Oil 15 To 20% With Rollerscrappingemerypaper320andwipeclean, Interiorwallfinishluster1st Coatwith Brush / Rubber / Spraywithmineralturpentine 7To 9%And Oilwithroller19 To 21% After8 Hours Of Activity Applying 2Nd Coat Or Wall Finish Lustre With Mineral Turpentine 7 To 9% Withbrushand Oil Withroller 19 To 21% After Allowing Dry For The Period Of 6 To 8 Hours Activity. ( With Prior Approval Of S.E. ) 800 Providingandapplyingroyaleluxuryemulsionofapprovedmakeoninternalwallsurfaceas Detailed Belowscrappingforsurfacewithemerypaperandwipecleanforarea. Wall Primer Withbrushby Adding Mineral Turpentine Oil By 8 To 10 % Or Water By 15 To 20% Allowing To Dryfor 6 To8 Hoursafter Applying Acrylic Wall Putty With Appropriate Prpportion Of Water Of Allow To Dry For Period Of4to6hours Ofactivity.Scrappingwithemerypaper Andwipecleanapplying Paints Royale Luxury Emulsion 1St Coatwithbrushwatercontentwater40to45%Or65to70%Byroleapplyingpaintsroyaleluxury Emulsion 2Nd Coat With Brush With Water Content 40 To 45%Or 65 To 70 % By Roller. ( With Prior Approval Ofs E ) 801 Providing Andfixing Indian Teak Woodplanking 25 Mm Thick For Flooring Plained On Both Sides, Tonguedand Grooved Including Scaffoldingif Necessaryandone Coat Of Primer Etc. Complete. 802 Providing And Fixing Indian Teak Wood Planking 50 Mm Thick For Flooring Plained On Bothsides, Tonguedandgrooved Including Scaffolding, Ifnecessary, Andone Coatof Primeretc. Complete. 803 Providing Andfixing Indianteakwoodjoistsandgirdersintimberfloors Ofsingle, Double Or Framedtypeincluding Scaffolding If Necessaryand One Coat Of Primer Etc. Complete. 804 Providingandfixingjungle ( Hard ) Woodofapprovedspeciesjoistsandgirdersintimberfloorofsingle, Double Or Framed Type Including Scaffolding If Necessary And One Primer Coat Etc.Complete 805 Providing Andfixing Indian Teakwoodplankceiling 20Mm Thickplainunderside Tonguedand Grooved Including Ironscrews, Scaffolding, Ifnecessary, Including Oneprimercoaton Under Side And One Coat Ofcoal Tar On Upper Side Etc. Complete. 806 Providing And Fixing Indian Teak Wood Framed Collar Beam / King Post / Queen Post Truss, With All Iron Workincluding Scaffoldingif Necessaryand One Coat Of Primer Etc. Complete. 807 Providingandfixinginteakwoodframedcollarbeam / Kingpost / Queenposttruss, Withallironworkincluding Scaffoldingif Necessary And Primer Coat Etc. Complete. 808 Providing Andfixing Country Teak Woodcommonrafters, Purlins Andpurlincleats, Hiprafters, Jack Rafters, Ridges, Wall Plates, Post Plates And Posts For Roofing Etc. Including Scaffolding, If Necessary, All Iron Work Andone Coat Of Primer Etc. Complete. 809 Providing And Fixing Teakwood Common Rafters, Purlins And Purlin Cleats, Hip Rafters, Jack Rafters, Ridges, Wallplates, Postplatesandpostsforroofing, Etc.Includingscaffolding, If Necessary All Iron Work Andone Coat Of Primer Etc.Complete. 810 Providing And Fixingteak Wood Hand Rail Of 60 Mm X 75 Mm As Per Detailed Drawings Or As Directed By The Engineer, Including French Polishing, Etc. Complete. ( Note : The Work To Be Executed On Preapproval Of Superintending Engineer ) . 811 Providing And Fixing Country Teak Wood Two Way Trellis Work With Battens Or Laths 2.5 Cm X1.2 Cm And5 Cm X 5 Cm Openings Including Frame Of 8 Cm X 5 Cm Vertical Andhorizontal Scantlings And Coat Of Primer Etccomplete 812 Providingandfixinghardwoodofapprovedspeciestwowaytrellisworkwithbattensor Laths 2.5Cm X 1.2 Cm And 5 Cm X 5 Cm Openings Including Frame Of 8 Cm X 5 Cm Vertical And Horizontal Scantlings And Coat Of Primer Etccomplete 813 Providing Andfixing Decorative Teakplywoodveneerlining 4Mmthickwithbacking Ofteakwoodframe Work Of Battens 12Mm X25mm At 30Cm Center To Center Fixedtowalls Andpillarswith 12 Mmthik Phywood Building Without Skirting And Cornice As Per Drawingsincludingnecessaryironworkand Finishing The Exposed Wood Work With French Polish Etc. Complete. 814 Providingandfixing20mmthicksuperiorveneerboardpelmetbox150to200mmwidetodoors Orwindow Frames Including 20Mm Dia. Aluminium Curtain Rod With Sockets Andfinishing Withfrench Polishing ( Without Top ) Etc. Complete. 815 Providingandfixing20mmthicklaminatedsheetboardpelmetbox150to200mmwidetodoors Or Window Framesincluding20mmdia.Aluminiumcurtainrodwith Socketsand Finishing With Frenchpolishing ( Without Top ) Etc.Complete. 816 Providingandfixing Indian Teakwoodeavesboards15cm Wide And25mm Thickplain Decorativetype Including Scaffolding And Painting With Two Coats Etccomplete 817 Providing And Fixing Seasoned And Treated Jungle Wood Of Approved Species Eaves Board 15 Cm Wide And 25 Mm Thick Plain Decorative Type Including Scaffolding And Painting With Twocoats Etc. Complete. 818 Providing And Fixing Teak Wood Eaves Plate Of Size 10Cm Wide And 20 Mm Thick Includingscaffolding And Painting In Two Coats Etc. Complete. 819 Providingandfixingcountryteakwoodbargeboard22cmwideand20mmthickplaintypeincludingscaffolding And Painting In Two Coats Etc. Complete. 820 Providing And Fixing Seasoned And Treated Jungle Wood Of Approved Species Barge Board 22Cmwideand20mmthickplaintypeincludingscaffoldingandpaintingintwocoatsetc. Complete. 821 Providing Andfixing Shutter To Wall Cupboard Made From 19 Mm Thick Teak Particle Board Withapproved Colouredlaminatedface1.5Mmthickbondedwithphenolformaldehyde Synthetic Resin B.W.P. Grade Including Lipping Beading Iron Oxidisedfixtures Andfastening And Oil Primer Coat Etc. Complete. ( Excludingcupboard Frame ) 822 Providing And Fixing Shutter To Wall Cupboard Consisting Of Teak Wood Styles And Rails 25 Mm Thick And 75 Mm Wide With Panel Insert Of 12 Mm Thick Particle Board With One Approved Colouredlaminatedfaceon One Side 1.5 Mm Thick, Bonded With Phenol Formaldehydesynthetic Resin Including Lipping Beading. Iron Oxidised Fixtures And Fastening And Oilprimercoatetc.Complete. ( Excludingcupboardf ) 823 Providing And Fixing Jungle Wood Ballies Ofapproved Species 85 Mm Average Dia. Forcommon Rafters, Purlins, Ridges, Hipandvalley Rafters, Jack Rafters, Wallplates, Postplates, Posts Etc. Including Alliron Work Scaffolding If Necessary And Oiling In One Coatetc. Complete. 824 Providing And Fixing 100 Mm Dia. Countryteak Wood Ballies For Post Truss Of 6.00 M.Span Asperdrawing Or As Directed By Engineerin-Charge Including All Iron Work, Scaffolding Ifnecessaryandoiling Etc.Complete. 825 Providing Andapplying Wax Polishing To The Oldwood Work Including Knotting, Preparingthe Surfacescaffolding Etc. Complete As Directed. 826 Providing And Fixing 3.5 To 4 Mm Thick Veneer Finish Wall Panaling Made Out Of 50 X 25 Mm ( Finished Size ) C.C.T.W.Frame Workorsize Of600x600mm Centeroraspersite Conditioncovered By 6 Mm Thick Marine Plywood Of The Generally Confiriming To I:S 710-1980Finished With 3.5 To 4 Mm Thick Matching Veneer Of Approved Color And In Satin Wallnut Groov Matched Veneer Pattern And Design Includingmelaminepolishing&Designwith Antitermitetreatmentetc.Toplywoodandwoodworkwith Ten Years Guarantee Bond Etc.Includingallleadandliftscompleteasperarchitectsdrawingand Instructions Of Engineer Incharge. 827 Providing And Fixing Mangalore Tiled Roofing With Class Aa Tiles Including Securing The Last Course Of Tiles Near The Eaves Withsteel Flat 40 Mm X 3Mm And1.22 Mm Wire Fixing 50 Mm X 25 Mmhorizontal Teak Woodbattensandironworksandoilingthebattensetc.Complete. ( Excluding Ridge And Hip Tiles ) . 828 Providing And Fixing Mangalore Tiled Roofing With Class Aa Tiles Including Securing The Last Course Of Tiles Near The Eaves With Steel Flat 40 Mm X 3 Mm And 1.22 Mm Wire Fixing Country Teak Woodsloping Battens Of25x 12Mm Teak Woodhorizontalbattens Of50mm X25mm Over The Slopping Battens, All Iron Work And Coal Tarring The Battens Etc. Complete ( Excluding Ridge And Hip Tiles ) . 829 ProvidingandfixingmangaloretileridgeandhiptilesofclassAaIncludingscaffoldingifnecessary, Pointing With Coloured Cement Mortar And Curing Etccomplete 830 Providing And Fixing Corrugated Galvanised Iron Sheets Of 0.63Mm Thick ( 24 B.W.G. ) Forroofing Without Wind Tiles Including Fastening With Galvanised Iron Screws And Bolts, Lead And Bitumen Washers As Perdrawing Etc. Complete. ( Weight Of 5.5 Kilogram / Sq.M. ) . 831 Providingandfixingplainzincsheetingof0.80Mmthick ( 22B.W.G. ) Overtheridgehiporvalleyto Galvanizedironsheetroofingincludingallfasteningandboltgalvanisedironscrewsandbolts, Leadandbitumen Washers Etc. Complete. ( Weight Of 6.8 Kilogram / Sq.M. ) . 832 Providing And Fixing6.00 Mmthick Isi Mark Asbestos Cement Corrugated Sheetroofing Including GalvanisedironJ Or L Hook Bolts Galvanisedironbandbituminous G.I. Washers, Galvanisedironclamps, Boltsnuts And Scaffolding Etc. Complete. 833 Providing And Fixing 6 Mm Thick Isi Mark Asbestos Cement Ridge Capping For Roofingincluding Galvanised Iron Hooks, Bolts, Galvanisediron And Bituminous Washers, Galvanised Ironclamps, Bolts, Nutsincluding Scaffolding Etc. Complete. 834 Providing And Fixing Valley Gutter Of 22 B.W.G. ( 0.8 Mm ) Plain Galvanised Iron Sheets 120 Cm Widewith Teakwood Planking20mmthickincludingtwocoatsofcoal-Tarringtheupper Surface Of Plank Etc.Complete ( Excluding Painting To Underside Of Plank ) 835 Providing And Fixing Valley Gutter Of 22 B.W.G. ( 0.8 Mm ) Plain Galvanised Iron Sheets 90 Cm Widewithteakwood Planking 20 Mm Thick Including Two Coats Of Coal-Tarring The Uppersurfaceofplanketc. Complete ( Excluding Painting To Underside Of Plank ) 836 Providing And Fixing Valley Gutter Of 24 B.W.G. ( 0.63 Mm ) Thick G.I. Sheet 120 Cm Wide With 20 Mm Thickteak Wood Planking Underneath Coal Tarring Etc. Complete. 837 Providing And Fixing Glass Tiles Of Mangalore Type At Required Places In Mangalore Tile Roofincluding Scaffolding If Necessary Etc. Complete. 838 Providing And Fixingmangalore Pattern Cowl Ventilator Tiles In Therequired Places In Amangaloretiled Roof Including Scaffolding If Necessary Etc. Complete. 839 Providing And Fixing False Ceiling Of Plain Asbestos Cement Sheets 4 Mm Thick With Teak Wood Beadings 45 X 12Mm Withframe Work Of Teak Woodbattens Of Size 70X60mm At 1.00M Center Tocenter Including Scaffolding, Ifnecessary, Allironworkandpainting ( Visible Surfaces ) To A.C. Sheet And Beading In Two Coats Etc. Complete. ( Excluding T.W. Runner To Be Paid Separately ) . 840 Providing Andfixing Frame Workofanodisedaluminium Sectionsforsuspendedfalse Ceiling Consisting Of Aluminium T 50 Mm X 40 Mm Weighing 0.39 Kilogram / M. At 60 Cms C / C And Fixed With ( 15 X 15 Mm ) Flanges Weighing 0.119 Kilogram / M Suspended On 6 Mm Dia. Mild Steel Rod Weighing 0.22 Kilogram / M Fixed On Wall And Beams Including Rounding Of The Edges With Aluminium T Of 50 Mm X 40 Mm Weighing 0.39 Kilogram / Metc. Including All Labour Etc. Complete. 841 Providing And Fixing Frame Work Of Galvanised Iron For Suspended False Ceiling Whichincludes Galvanisedironperimeterchannelsofsize27mmand0.5Mmthickhavingone Flange Of 20 Mm And Another Of 30Mm Along With Perimeter Of The Ceiling, Fixing Inbrick Wall / Partitionwith Thehelp Of Rawal Plugs And Screws, Suspending Galvenised Ironintermediatechannelsofsize45mm And0.9Mm Thick With Two Flanges Of 15 Mm Each From The Soffit At 1200 Mm Centers Withsteel Galvanisediron Hanger Of Width25 Mm X 0.5Mm Fasteners, Ceilingsectionof0.5Mmthicknesshavingcurvedwedgeof51.5 Mmandtwo Flanges Of 26 Mm Each With Lips Of 10.5 Mm Fixed To The Intermediate Channel With The Help Of Connecting Clips And In Direction Perpendicular To The Intermediate Channel At 450 Mm Centers, 12.5 Mm Dry Walls Screws At 230 Mm Centers; Fixing Screws Mechanically Either With Screw Driver Or Drilling Machine With Suitable Attachment Etc. Complete. 842 Providing Andfixing False Ceiling Of Teak Woodparticle Boardhalf Perforated Sheet 12Mm Thick Including Scaffolding, If Necessary, All Iron Work And Two Coats Of Oil Painting To Boards And Beading I.E. Visible Surfaceetc. Complete. ( Excluding Frame Work And Runners ) 843 Providing And Fixing False Ceiling Of 10 To 12 Mm Thick Decorative Boards Of Fibrous Plaster Of Paris Including Scaffolding If Necessary All Architectural Work Like Mouldings, Cornices, Coves, Domes, Cupsasperdetailed Drawingsandthreecoatsofspraypaintingtoboardsetc. Complete. ( Excluding Frame Work, Runners Andmild Steel Suspenders ) . 844 Providing And Fixing False Ceiling Of 12Mm Thickas Per Drawings Including Powder Coated G.I. Wall Angle Of 20Mm X 20Mm Size, G.I. Gridrunners Of Size 20Mm X 38Mm At 600Mm Centertocenterbothwaysand Suspended Using G.I. 3Mm Wire Including Fixing Usingbutterfly Clips And Fasteners Including Transporting, Scaffoldingallnecessarylabourand Machinery, Finishing Etc. Complete. 845 Providing Andfixing False Ceiling Of 15Mm Thick As Per Drawings Including Powdercoated G.I. Wall Angle Of 20 Mm X 20 Mm X 0.60 Mm Size, G.I. Grid Runners Of Size 15 Mm X 38 Mm At 600 Mm Center To Center Both Waysandsuspendedusingg.I.3Mmwireincludingfixingusingbutterflyclipsandfastenersincluding Transporting, Scaffolding All Necessary Labour And Machinery, Finishing Etc. Complete. 846 Providing And Fixing False Ceiling Of T.W. Partical Board Half Perforated Sheets 12 Mm Thick With Frame Work Of M.S. Angle 40 X 40 X 5 Mm And T Of Size 40 X 40 X 6 Mm At 60 Cm Center To Center Including 12 Mm Dia. Hangers, T.W. Battens 50 X 25 Mm And Beading 25 X 15 Mm Thick Scaffolding, If Necessary, All Iron Work And Two Coats Of Painting To Boards And Beadingi.E. Visible Surface Etc. Complete. 847 Providing And Fixing False Ceiling Of 12 Mm Thick Laminated Board With Frame Of M.S. Angle 40 X 40 X 5 Mm And Tee Of Size 40 X 40 X 6Mm At 60 Cm C / C Including 12 Mm Dia. Hangers, T.W. Battens 50 X 25 Mm Andbeading 25 X 15Mm Thick Scaffolding If Necessary, All Iron Work Etc. Complete. 848 Providingandapplyingtwocoatsofbitumentoroofonnewdungareeclothonecoatoneachsideetc. Complete As Directed. 849 Providing Andapplying One Coatofbitumentoroof ( Withoutcloth ) Including Scaffoldingetc.Completeas Directed. 850 Removingandresettingmangaloretilesfromroofincludingrefixingloosebattensetc. Complete. 851 Removingthetiles, Battensanddungryclothpurlins, Raftersandridgesetc.Fromroof, Sortingoutthe Serviceableandunserviceablematerialsandstackingthesameasandwheredirectedinthecompound, Scaffolding Etc. Complete. 852 Removing G.I. Or A.C. Sheet Roofing Including Purlins, Principal Rafters Etc. Including Sorting Serviceableand Unserviceablematerials, Stackingthesameasandwheredirectedinthe Compound Including Scaffoldingetc. Complete. 853 Removing Andlowering The Roof Truss Carefully Without Damaging The Members And Stacking As Andwhere Directed In The Compound Including Scaffolding Etc. Complete. 854 Removing R.S. Girders Of Any Size And Span Lowering The Same And Stacking Neatly Wherever Directed In The Compound Scaffolding Etc. Complete. 855 Providing Fixing Countryteak Wood Battens 50 Mm X 25 Mm For Mangalore Tile Roof Work With All Iron Workscaffolding And Oiling The Battens Etccomplete 856 Providing Fixing Teak Wood Battens 25 Mm X 12 Mm For Mangalore Tile Roof Work With Iron Work Scaffolding And Oiling The Battensetc. Complete. 857 Providing And Fixing Sky Light In R.C.C. Roof Including Frame Made Of M.S. Angle 50 X 50 X 6 Mm With Holdfast, Sheet Glass 12 Mm Thick, Chicken Mesh 24 Gauge With All Accessories And Required Fixtures And Fastening Fitting Including Painting Etc. Complete. 858 Providingandfixing12mmdia.Mildsteelbarupto0.5M.Lengthforanchorrodswith Necessarythreading Nuts And Bolts Etc. Complete. 859 Providing Fixing Mangalore Tile Roofing With Class Aa Tiles In Cement Mortar 1:4 On Sloping Slab Includingnecessary Scaffoldingcuringfinishingetc. Complete. 860 Providing Andfixing Colourcoatedzincalume ( R ) Az150 ( Min150gms / Sq.Mt.Totalon Each Side ) Profiled Sheets For Roofing. The Feed Material Is Manufactured Out Of Nominal 0.45 Mm Base Metal Thickness ( Bmt ) ( 0.5 Mm Tct ) , Hi-Strength Steel With Min.550 Mpa Yield Strength, Metallichotdipcoatedwith Aluminium-Zincalloy ( 55%Aluminium 43.4%Zinc 1.6% Silicon ) With Colorbond ( R ) Steel Quality Superdurablepolyesterpaintcoat ( Withinorganic Pigment ) . The Paint Shall Have A Total Coating Thicknessofnominal35um, Comprising Of Nominal 25 Um Exterior Coat On Top Surface And Nominal 10 Um Reverse Coat On Back Surface. Profile Sheet Shall Have Nom. 950-1050 Mm Effective Cover Width And Nominal 25-30 Mm Deep Ribs With Subtle Square Fluting In The Five Pan At Nominal 180-250 Mm Center- To-Center.The Endribshallbedesignedforanti-Capillarygroove.Andreturnleg.Thefeed Material Should Have Coil Manufacturers Product Details Marked A Regular Interval. Including Fasteners With Min. Fastened With Min. 25 Um Zinc-Tin Alloy Coated, Hex Head, Self-Drilling Screw Etc. Complete. ( Weight Of Profile 4.52Il / Sme 861 Providing And Fixing Of Colour Coated Zincaluminium ( R ) Az150 ( Min 150 Gms / Sq.Mt. Total On Each Side ) Profiled Sheets For Roofing. The Feed Material Is Manufactured Out Of Nominal 0.45 Mm Base Metal Thickness ( Bmt ) ( 0.5Mmtct ) , Hi-Strengthsteelwithmin.550Mpayieldstrength, Metallichotdipcoated Withaluminium-Zincalloy ( 55%Aluminiumm43.4%Zinc1.6%Silicon ) Withcolorbond ( R ) Steel Qualitysuperdurablepolysterpaintcoat ( With Inorganicpigment ) .Thepaintshall Havea Totalcoating Thickness Ofnominal 35Mm, Comprising Of Nominal 25Mmexterior Coat On Top Surface And Nominal 10 Um Reverse Coat On Back Surface. Profile Sheet Shall Have Nom. 950-1050 Mm Effective Cover Width And Nominal 25-30 Mm Deep Ribs With Sublet Square Fluting In The Five Pan At Nominal 180-250 Mmcenter- To-Center.The Endribshallbedesignedforanti-Capacitygroove.Andreturnleg.Thefeed Material Should Have Coil Manufacturers Product Details Marked A Regular Interval. Including Fasteners With Min. Fastened With Min. 25 Um Zinc-Tin Alloy Coated, Hex Head, Self-Drilling Screw Etc. Complete. ( Weight Of Profile 4.52 862 Providing And Fixing Of Colour Coated Zinc Aluminium ( R ) Az150 ( Min 150 Gms / Sq.Mt. Total On Each Side ) Profiled Sheets For Roofing. The Feed Material Is Manufactured Out Of Nominal0.45 Mm Base Metal Thickness ( Bmt ) ( 0.5 Mm Tct ) , Hi-Strength Steel With Min.550 Mpa Yield Strength, Metallichotdipcoatedwithaluminium-Zincalloy ( 55%Aluminiumm43.4%Zinc1.6%Silicon ) With Colorbond ( R ) Steel Quality Super Durable Polyster Paint Coat ( Withinorganicpigment ) .Thepaint Shallhave Atotalcoatingthicknessofnominal35um, Comprising Of Nominal 25Um Exterior Coat On Top Surface And Nominal 10 Um Reverse Coat On Back Surface. Profile Sheet Shall Have Nom. 950-1050 Mm Effective Cover Width And Nominal 25-30 Mm Deep Ribs With Subtle Square Fluting In The Five Pan At Nominal 180-250 Mm Center- To-Center.Theendribshallbedesignedforanti-Capacitygroove.Andreturnleg.Thefeed Materialshouldhave Coilmanufacturersproduct Detailsmarkedaregular Interval.Including Fastenerswith Min. Fastened With Min. 25 Um Zinc-Tin Alloy Coated, Hex Head, Self-Drilling Screw Etc. Complete. ( Weight Offil 4 52 Kil / Me ) 90 I H ( Sfwid H ) 863 Providing And Fixing Upvc Roof Made Up Of 3 Layers Roofingmaterial Of Thickness 2Mmhaving Width Of 1130 Mm And Of Required Length Having Tensile Strength Not Less Than 330 Kilogram / Cm2, Including Fastening With Self Drilling Screw Having Washers Made Of Stainless Steel Etc. Complete. 864 Providing Andfixing Pvccolouredridge Tiles Overupvc Roofing Where Requiredhaving Size113cmx 41Cm Forridgeincludingfasteningwithselfdrillingscrewhavingwashers Made Of Stainless Steel Etc.Complete. 865 Providingandfixing15mmthickeco-Friendlydensifiededgecalciumsilicatefalseceilingof Approved Texture Of Size 595Mm X 595Mm In Truehorizontallevel, Suspendedoninterlocking Metalgridofhot Dipped Galvanized Steel Sections ( Galvanisingat@12Gm / Sq.Mincludingbothsides ) Consistingofmaint Runnersuitably Spaced At Joints To Get Required Length And Size 24X38mm. Made From 0.33Mm Thick ( Minimum ) Sheet, Spaced1200mmcentertocenterandcrosstofsize24x28mmmadeof0.33Mm Thick ( Minimum ) Sheetto Be Interlockedatthe Middle Of The 1200X600mm Panel Toform The Gridofsize 600X600mmrestingonperipherywalls / Partitionsonaperimeterwallangleprecoatedsteelofsize 24X24x3000 Made Of 0.4 Mm Thick ( Minimum ) Sheet Withthe Help Of All Plugs At 450Mm And Laying 15 Mm Thickdensifiededgescalciumsilicateceilingtilesofapprovedtexture ( Spintone / Cosmos / Hexa ) Inthegrid, Including Light Fittings , Fixtures , Smoke Detectors Etc., Wherever Required. Main T Runners Suspendedfrom Ceiling With Using G.I. Slottedcleats Of Size 25X35x1.6Mm Fixedto Ceiling Using 12.5Mm Dia. And50mm Longdashfasteners, 4Mmg.I.Adjustablerodswithgalvanizedsteellevelsclipsofsize 866 Providing And Fixing False Ceiling With Eco-Friendly Light-Weight Calcium Silicate Tiles Ofspintone Surface Texture Aerolite Make Or Equivalent Of Size 595Mm X595mm Having 15Mm Thickdensified Micro Lookedgeand100%Humidityresistanceincombustibleasperbs 46Part Iv And Thermal Conductivity0.043 W / M 0 Kc And Nrc 0.50 Placed In True Horizontal Levelsuspendedgridofsize600x600mmmade Fromhotdippedg.I.Steelsectionsion Silhouette Profile, Rotary Stitched Double Webbed White With 6Mm Reveal Profile ( White / Black ) , Wherein, Maint Runner Of Size 42Mmx14mm Between Main Tee 600Mm Center- Tocenterandsecondarycrosstofsize 33X14x0.43Mm Thickoflength600mm Long Spacedinter-Lockedat Middleofthefirstcrossedtineachpaneltoformgridof1200mmx600mmrestingonperiphery Wallprofilewallsection19mm ( 7+7 ) X19mmx0.40Thicknessesandlayingfalse Ceiling Forservices Like Diffusers Grills Includingcutting, Makingopeningfor Light Fittings, Fixtures, , Smokedetectors Etc., Whereverrequired. Maint Runnerssuspendedfrom Ceiling With Using G.I. Soffit Cleats Of Size 25X35x1.6 Mm Of Required Length Fixed To The Ceiling With 6Mmdiaand 50Mmlongdash Fastener, 4Mmdiag.I. 867 Providing And Fixing Self Supporting Steel Roofing Systemfor A Godown Or Alike Made Up Of Structural Grade Steel Sheet Of 912 Millimeter Width ( Tolerance + / - 2 Millimeter ) , Moulded At Site Using Mechanical Press Dies To The Desired Curve And Shape To Form 605 Millimeter Wide Interlocking Panels . The Interlocking Panels Shall Be Pressedtoclose The Seam Forming Watertightjointsfor Aspanof15.30Meterhaving Archrise As3.06 Meter, Arch Length 17.75 Meter. The Base Material Made Up Of Importedgalvalume Steelcomplying To Astm A792having Base Metal Thickness Of 0.80 Millimeter ( Tolerace + / - 0.02 Millimeter ) With Alloy Coating Az 150Andpaint Coating Of Regular Modifiedpolyster , Topcoat 25Micronandbottom Coat 12Micronas Per Approved Colour , Including Fixing Hangers , Clamps Etc.As May Be Necessary Of Proflex Standard, Including Fixing Sky Light Of 2 Millimeter Thick Polycarbonate Sheet Of Size 2 X 7 And Turbo Ventilator Of 24 Diameter To Be Installed At Every 30 Feet Along The Length Of Roof Including Finishing, Testing And Cleaning Etc. Complete. 868 Providing And Fixing Self Supporting Steel Roofing Systemfor A Godown Or Alike Made Up Of Structural Grade Steel Sheet Of 912 Millimeter Width ( Tolerance + / - 2 Millimeter ) , Moulded At Site Using Mechanical Press Dies To The Desired Curve And Shape To Form 605 Millimeter Wide Interlocking Panels . The Interlocking Panels Shall Be Pressedtoclose The Seam Forming Watertightjointsfor Aspanof21.30Meterhaving Archrise As4.26 Meter, Arch Length 25.13 Meter. The Base Material Made Up Of Importedgalvalume Steelcomplying To Astm A792having Base Metal Thickness Of 1.00 Millimeter ( Tolerace + / - 0.02 Millimeter ) With Alloy Coating Az 150Andpaint Coating Of Regular Modifiedpolyster , Topcoat 25Micronandbottom Coat 12Micronas Per Approved Colour , Including Fixing Hangers , Clamps Etc.As May Be Necessary Of Proflex Standard, Including Fixing Sky Light Of 2 Millimeter Thick Polycarbonate Sheet Of Size 2 X 14 And Turbo Ventilator Of 24 Diameter To Be Installed At Every 30 Feet Along The Length Of Roof Including Finishing , Testing And Cleaning Etc. Complete. 869 Providing And Fixing Self Supporting Steel Roofing System For A Godown Or Alike Made Up Of Structural Grade Steel Sheet Of 912 Millimeter Width ( Tolerance + / - 2 Millimeter ) , Moulded At Site Using Mechanical Press Dies To The Desired Curve And Shape To Form 605 Millimeter Wide Interlocking Panels . The Interlocking Panels Shall Be Pressedtoclose The Seam Forming Watertightjointsfor Aspanof25.00Meterhaving Archrise As5.00 Meter, Arch Length 29.00 Meter The Base Material Made Up Of Importedgalvalume Steelcomplying To Astm A792having Base Metal Thickness Of 1.20 Millimeter ( Tolerace + / - 0.02 Millimeter ) With Alloy Coating Az 150Andpaint Coating Of Regular Modifiedpolyster , Topcoat 25Micronandbottom Coat 12Micronas Per Approved Colour , Including Fixing Hangers , Clamps Etc.As May Be Necessary Of Proflex Standard, Including Fixing Sky Light Of 2 Millimeter Thick Polycarbonate Sheet Of Size 2 X 14 And Turbo Ventilator Of 24 Diameter To Be Installed At Every 30 Feet Along The Length Of Roof Including Finishing , Testing And Cleaning Etc. Complete. 870 Providing And Fixing Self Supporting Steel Roofing Systemfor A Godown Or Alike Made Up Of Structural Grade Steel Sheet Of 912 Millimeter Width ( Tolerance + / - 2 Millimeter ) , Moulded At Site Using Mechanical Press Dies To The Desired Curve And Shape To Form 605 Millimeter Wide Interlocking Panels . The Interlocking Panels Shall Be Pressedtoclose The Seam Forming Watertightjointsfor Aspanof28.75Meterhaving Archrise As5.75 Meter, Arch Length 33.92 Meter. The Base Material Made Up Of Importedgalvalume Steelcomplying To Astm A792having Base Metal Thickness Of 1.40 Millimeter ( Tolerace + / - 0.02 Millimeter ) With Alloy Coating Az 150Andpaintcoatingofregularmodifiedpolyster, Topcoat25micronandbottomcoat12micronas Perapproved Colour , Including Fixing Hangers , Clamps Etc.As May Be Necessary Of Proflex Standard, Including Fixing Sky Light Of 2 Millimeter Thick Polycarbonate Sheet Of Size 2 X 14 And Turbo Ventilator Of 24 Diameter To Be Installed At Every 30 Feet Along The Length Of Roof Including Finishing , Testing And Cleaning Etc. Complete. 871 Providing And Fixing Ofmineral Fibre Board Acoustical Suspended Ceiling System Withultima ( Bevelledtegular ) Edge Tilesofsize 15Mm Exposedgrid.The Tilesshouldhave Humidity Resistance ( Rh ) Of99%, Nrc0.7, Lightreflectance 85%, Thermalconductivityk=0.052-0.057W / M K, Colour White, Fire Performance Uk Class 0 / Class 1 ( Bs 476 Pt - 6 &7 ) In Module Size Of 600 X 600 X 20Mm , Suitable For Greenbuilding Application, Withrecycledcontent Of 32%.The Tile Shall Be Laidonprecoated G.I.Channel Onxl2 Clip Having A Web Height Of 32 Mm With15 Mm Wide T - Section Flanges Colour White Having Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm And 600 Mm Cross Tees With A Web Height Of 32 Mm Anda Load Carrying Capacity Of 7.7 Kilograms / M2 Andminimum Pull Out Strength Of 100 Kilograms.. The T Sections Have A Galvanizing Of 90 Grams Per M2 And Need To Be Installed With Suspension System. The Tile And Grid System Used Together Should Carry A 10 Year Warranty. Products Approved As Per Griha And Bs 476 Etc. Complete. 872 Providing And Fixing Of Mineral Fibre Suspendedceiling System With Bioguard ( Bevelled Tegular ) Edge Tileswith 15Mmexposedgrid.Thetilesshouldhavehumidity Resistance ( Rh ) Of99%, Light Reflectance 90%, Thermal Conductivityk =0.052-0.057 W / M K, Colourwhite, Fireperformanceuk Class 0 / Class 1 ( Bs 476 Part 6 And 7 ) , Inmodulesizeof600x600x16mmwithantimicrobial Coating On The Face Of The Tile, Suitable Forgreenbuildingapplication, Withrecycledcontentof34%. Thetileshallbelaidon Precoated G.I. Channel Onxl2 Clip Havinga Web Height Of 32 Mm32 With 15 Mm Wide T - Section Flanges Colour White Having Rotary Stitching On All T Sections I.E. The Main Runner And 1200 Mm Cross Tees With A Web Height Of 32 Mm And A Load Carrying Capacity Of 7.7 Kilograms / M2 And Pull Out Strength Of 100Kilograms. . The T Sections Have A Galvanizing Of 90 Grams Per M2 And Need To Be Installed With Suspension Systemthe Tile And Grid System Used Together Should Carry A 10 Year Warranty. Products Approved At Griha And Bs 476 Etc. Complete. 873 Providing And Fixingsoft Fibre Acoustical Suspended Ceiling System With Optra ( Bevelled Tegular ) Edge Tiles Of Size 15Mm Exposed Grid. The Tiles Should Have Humidity Resistance ( Rh ) Of 95%, Nrc 0.9 - 1.0, Light Reflectance ?85%, Colour White, Fire Performance Uk Class 0 / Class 1 ( Bs 476 Pt - 6 &7 ) In Module Size Of 600 X 600 X 15Mm , Suitable For Green Building Application, With Recycled Content Of 66% Gw And 74% Rw. The Tile Shall Be Laid On Precoated G.I Channel 32 With 15 Mm Wide T - Section Flanges Colour White Having Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm And 600 Mm Cross Tees With A Web Height Of 32 Mm And A Load Carrying Capacity Of 7 Kilograms / M2 With A Minimum Pull Out Strength Of 100 Kilograms. The T Sections Have A Galvanizing Of 90 Grams Per M2 And Need To Be Installed With Suspension System The Tile And Grid System Used Together Should Carry A 10 Year Warranty.Products Approved As Per Griha And Bs 476 Etc. Complete. 874 Providing And Fixing Of Gi Lay In Plain Metal Ceiling Consisting Of 600X600mm Lay In Tiles Of Pre Coated Galvanized Steel In 0.5 Mm Thickness In Global White Color Tile To Be Laid Ongrid Systems With 15Mm Wide T - Sectionflangescolorwhitehavingrotarystitchingonthemainrunner, 1200 Mmand 600Mmcross Tees.Providing Andfixing Of Gi Lay In Plainmetal Ceilingconsistingof600x600mmlayintilesofpre Coated Galvanized Steel In 0.5 Mm Thicknessinglobalwhite Colortile To Be Laidongridsystemswith 15Mm Wide T - Section Flanges Color White Having Rotary Stitching On The Main Runner, 1200 Mm And 600 Mm Cross Tees.Products Approved As Per Griha And Bs 476 Etc. Complete. 875 Providing And Fixingmineral Fibre Acoustical Suspended Ceiling System With Dune ( Bevelled Tegular ) Edgetilesofsize15mmexposedgrid.Thetilesshouldhavehumidityresistance ( Rh ) Of 99%, Nrc 0.5, Light Reflectance 85%, Thermal Conductivity K = 0.052 -0.057 W / M K, Colour White, Fire Performance Uk Class 0 / Class 1 ( Bs 476 Pt - 6 &7 ) In Module Size Of 600 X 600 X 16Mm , With Recycled Content Of 35 %. The Tile Shall Be Laid On Precoatedg.I.Channelheight 32 With15mm Wide T -Section Flangescolour White Having Rotary Stitching And Xl2 Clip On All T Sectionsi.E.The Mainrunner, 1200Mm And600mm Crosstees Witha Webheight Of32mm Anda Loadcarrying Capacityof7.57Kilograms / M2andpulloutstengthofminimum100kilograms..Thetsectionshavea Galvanizing Of 90 Gramsper M2andneedto Be Installed Withsuspension System.The Tile Andgrid Systemused Together Should Carry A 10 Year Warranty.Approved As Per Griha And Bs 476 Etc. Complete. 876 Providingandfixingmineralfibreacousticalsuspendedceilingsystemwithfinefissured ( Bevelled Tegular ) Edgetilesofsize15mmexposedgrid.Thetilesshouldhavehumidityresistance ( Rh ) Of 99%, Nrc 0.6, Light Reflectance 85%, Thermal Conductivity K = 0.052 -0.057 W / M K, Colour White, Fire Performance Uk Class 0 / Class 1 ( Bs 476 Pt - 6 &7 ) In Module Size Of 600 X 600 X 16Mm , With Recycled Content Of 31 %. The Tile Shall Be Laid On Precoated G.I Channel Height Of 32 With 15 Mm Wide T - Section Flanges Colour White Having Rotary Stitching And Xl2 Clip On All T Sections I.E. The Main Runner, 1200 Mm And 600 Mm Cross Tees With A Web Height Of 32Mm And A Load Carrying Capacity Of 7.57 Kilograms / M2 And Pull Out Stength Of Minimum 100 Kilograms.. The T Sections Have A Galvanizing Of 90 Gramsper M2andneedto Be Installed Withsuspension System.The Tile Andgridsystem Used Together Should Carry A 10 Year Warranty. Product Approved In Griha And Bs 476 Etc. Complete. 877 Providing And Fixing In Position Gypsumboard False Ceilingwith 12.5 Mm Thick Gypsumboards, Screwed / Fixedtotheunderstructureofsuspendedg.I.Gridconstructedand Suspended From The Main Ceilingconsistingofceilingsectionsofsize25x50mmmaximumcenter To Center Distance Of 600 Milimetre Perimeter Channel And Intermediate Channels Atmaximum Center To Center Distance 1200 Milimetregalvanizedgridshouldbefixedto Reinforced Cement Concrete Slab. The Gypsum Board Should Be Fixed To Galvanized Iron Grid With Necessary Screws.The Boards Should Be Taped And Filled From Underside To Give Smooth, Seamless Ceiling. The Rate Should Include Necessary Additional Ceiling Sections And Intermediatechannels. Additionalintermediatechannelsshouldbefixedtostraphangersforadditional Support To Prevent Strapping At Every 1200 Milimetre Item To Be Completed Inall Respect Including Necessary Sleeves For Ducts Finishing Of Joints Cut Outs, Painting Including Labour, Material, Lifts Etc. All Complete. 878 Providing And Fixing Modular False Ceiling Of 600 X 600 Mm Center To Center And 13 Mm Thick Square Mineral Fiberboardtobefixedonframeworkofalluminiumsectionsforsuspendedfalse Ceiling Consisting Of Alluminiumt2?X1½? ( 50Mmx40mm ) Weighing0.39 Kilogram / M At 60 Cms Center Center And Fixed With ½? X ½? ( 15 X 15 Mm ) Flanges Weighing0.19 Kilogram / M Suspended On 6 Mm Dia Mild Steel Rod Weighing 0.22 Kilogram / M, Fixed On Wall And Beams Including Rounding Of The Edges With Alluinium T Of2?X 1½? ( 50 Mm X 40 Mm ) Weighing 0.39 Kilogram / M Etc. ( All Alluminium Sections Shall Be Anodized ) Including All Labour, Material, Lifts Etc. Complete. 879 Providingandfixingselfsupportingsteelroofingsystem ( Proflex ) Foragodownoralikemadeupof Structuralgradesteelsheetof912millimeterwidth ( Tolerance+ / -2Millimeter ) , Mouldedatsiteusing Mechanical Press Dies To The Desired Curve And Shape To Form 605 Millimeter Wide Interlocking Panels . The Interlockingpanelsshallbepressedtoclosetheseam Formingwatertightjointsforaspanof32.5Meter Having Arch Rise As 6.5 Meter, Arch Length 37.7 Meter. The Base Material Made Up Of Imported Galvalume Steel Complying To Astm A792 Having Base Metal Thickness Of 1.60 Millimeter ( Tolerace + / - 0.02 Millimeter ) With Alloy Coating Az 150 And Paint Coating Of Regular Modified Polyster , Top Coat 25 Micron And Bottom Coat 12Micronasperapprovedcolour, Includingfixinghangers, Clampsetc.Asmaybenecessaryofproflex Standard, Includingfixingskylightof2millimeterthickpolycarbonatesheetofsize2X14Andturbo Ventilator Of 24 Diameter To Be Installed At Every 30 Feet Along The Length Of Roof Including Finishing , Testing And Cleaning Etc. Complete. 880 Providing And Fixing Frame With / Without Ventilator Of Size As Specified With Country Cut Teak Wood For Doors And Windows Including Chamfering, Rounding, Rebating, Iron Holdfast Of Size 300Mm X 40Mm X 5Mm With Oilpaintingetc. Complete 881 Providing Andfixing Frame With / Without Ventilatorof Size As Specifiedwithcountrynon Teak Wood Fordoors And Windows Including Chamfering, Rounding, Rebating, Iron Holdfast Of Size 300Mm X 40Mm X 5Mm With Oil Paintingetccomplete 882 Providing Andfixing The Countrycut Teakwoodsecondclass Fullyglazedopenable Fanlight Rectangularin Shapeasperdetaileddrawingexcludingtheframe, Stainlesssteelfixturesandfasteningsandfinishingthewood Work With 3 Coats Of Oil Painting 883 Providing And Fixing Country Cut Teak Wood Double Or Single Leaf Second Class Fully Panelled Door Shutter With 35Mmthickstyleandrailwith25mmthickpanelswithopenablefanlightasperdetailed Drawings. Excluding The Door Frame 60Mm X 100Mm Stainless Steel Fixtures And Fasteningand Finishingthewood Workwithoilpainting3coats. ( Excludingthedoor Frame ) 884 Providing And Fixing Country Cut Teak Wood Single Leaf Panelled Door Shutter Without Fanlight And 25Mm Thick As Per Drawing Consisting Of T.W.Toprailsize 100Mm X25mm Andbottom Lockrail 200Mmx 25Mm Insert Pannel 12 Mm Thick Commercial Ply Faced T.W. Particleboardwithphenolformaldehyde Synthetic Resin ( Generally Confirming To Isi 3097 ) Excluding Frame, Includingstainlesssteelfixtureand Fasteningandt.W.Beadingtojunctionsof Panelled Inserts And As Instructed By The Engineer In Charge Including 3 Coats Of Oil Painting Etc. Complete. 885 Providingandfixingsingleleafpanelleddoorshutterwithoutfanlightandshutter35mm Thick As Per Drawing Consisting Of T.W. Top Rail Size 100Mm X 35 Mm And Bottom And Lock Rail 200Mm X 35Mm Insert Panel12mm Thickcommercialplyfacedt.W.Particle Boardwithphenol Formaldehyde Synthetic Resin ( Generallyconfirmingtoisi3097 ) Excludingframe, Including Stainless Steel Fixtures Fastening And T.W. Beadingatjunctionofpanelsinsertsandasinstructedbytheengineerinchargeincluding3coatsofoiliti T Lt 886 Providingandfixingsingleordoubleleafpanelleddoorshutterexcludingframewithglazedopenable Fanlightshutter35mmthickasperdetaileddrawingconsistingpanelledvertical Styles 100 Mm X 35 Mm And Lock And Bottom Rail 200 Mm X 35 Mm And Panels 12 Mm Thick Both Side Commercial Ply Faced Particle Board Including Stainless Steel Fixtures And Fastening And T.W. Beading At Junctions Of Panel Insertsandas Instructedbytheengineerinchargeincluding3coatsofoilpaintingetc. Complete. 887 Providing And Fixing Country Cut Teak Wood Double Or Single Leaf Panelled Shutters, 35 Mm Thick Style Top And Freze Rail 95 X 35 Thick With Lock And Bottam Rail 195 X 25 Mm Thick And Panelswithoutventilatorasper Detaileddrawingexcludingthedoorframe, Stainlesssteel Fixtures And Fastening And Finishing The Woodwork With Oil Painting 3 Coats Complete 888 Providing And Fixing Solid Core Flush Door Shutter In Single Leaf 32 Mm Thick Decorative Type Of Exterior Grade As Per Detailed Drawings Approved Face Veneers 3 Mm Thick On Both Faces Or As Directed, All Necessary Beads, Mouldingsandlipping, Wroughtironholdfasts, Chromiumplated Fixtures And Fastenings, With Brass Mortiselock, Chromiumplatedhandlesonboth Sides, And Finishing With French Polish Etc. Complete. 889 Providing And Fixingsolid Coreflush Door Shutter Commercial In Single Leaf 32 Mmthickwithout Ventilator Commercial Type Of Exterior Grade As Per Detaileddrawings Withwrought Iron Hold Fast, Stainless Steel Fixtures And Fastenings And Handles On Both Sides And Finishing With Oil Painting 3 Coats Complete. 890 Providing And Fixing Solid Core Flush Door Commercial Type On Single Leaf 16 Mm Thick Bison Panel Cement Bonded Particle Board Including Teak Wood Lipping Beading On All Four Edges Without Ventilator Commercial Typeofexteriorgradeasperdetailed Drawingswith Wroughtironholdfast, Stainlesssteelfixturesand Fastenings And Handles On Both Sides And Finishing With Oil Painting Three Coats Complete. 891 Providing And Fixing Country Cut Teak Wood Single Leaf Door Shutter With Teak Wood Style And Rail Of 25 Mm Thick Including Fixing 50 Mm X 25 Mm Size Welded Mesh Of 10 Gauge As Per Detailed Drawing Or As Directed With Stainless Steel Fixture And Fastening Finishing With 3 Coats Of Oil Painting Etc. Complete. 892 Providingandfixingfactorymadepanelleddoorshutterinsingle Leaf35mm Thickstyleandrailwithout Ventilator With Cctw Panels 12 Mm Thick Including Wrought Iron Hold Fast And Stainless Steel Fixtures Withoil Painting 3 Coats Etccomplete 893 Providing And Fixing Country Cut Teak Wood Single Leaf Panelled Door Shutters 35 Mm Thick Style And Rail And19 Mm Thickt.W. Panels As Per Detailed Drawing Including Wrought Iron Hold Fast Stainless Steel Fixtures And Fastening And Three Coats Of Oil Painting Etccomplete 894 Providing And Fixing Fully Glazed Double Leaf Window Shutter With Openable Fanlightincluding Countrycutteakwood25mmthickstyleandrailswithplain / Obscuredglass Panels 5 Mm Thick As Per Drawing Or As Directed By The Engineer In Charge With Stainless Steel Fixtures And Fastening And Finishing The Wood Work With Oil Painting Three Coats Etc. Complete. 895 Providing Andfixing Country Cut Teak Wood Windowwith Double Leaf Half Glazed Andhalf Panelled Shutter Withstyle70x20mmthickrails95x20mm Thickandpannels15mmthickwith Ventilator Including Wrought Iron Hold Fast, Stainless Steel Fixtures And Fastenings Andfinishingthewoodworkwithoilpainting 3 Coats Etccomplete 896 Providing And Fixing Country Cut Teak Wood Windows With Double Leaf 25 Mm Thick Planked Shutterswithout Ventilators Asper Detailed Drawings Includingstainlesssteelfixtures And Fastenings And Finishing Thewood Work With Oil Painting 3 Coats Etc. Complete 897 Providing And Fixing Country Cut Teak Wood Windows / Ventilators With Double Leaf Panelled Shutters25mm Thick Without Ventilators As Per Detailed Drawing Including Stainless Steelfixturesandfasteningsandfinishing The Wood Work With Oil Painting 3 Coats Etccomplete 898 Providingandfixingsteelwindowofvarioussizesasperdetaileddrawingwithouthotdipzinccoating, Without Ventilators, Including Fabricating / Glazing With Plain / Obscuredglass Panels Of Approvedtype And Qualityiron Oxidised Fixtures And Fasteningsoil Painting Two Coats Complete 899 Providingandfixingsteelwindowofvarioussizesasperdetaileddrawingwithouthotdipzinccoating, Without Ventilators, Including Fabricating / Glazing With Plain / Obscuredglass Panels Of Approved Type And Quality, Iron Oxidised Fixtures And Fastenings, Finishing With Oil Painting Two Coats Complete ( With Guard Bars12 Mm Square At 10 Cm C / C. ) 900 Providing And Fixing Steel Window C.R.C. Sheet As Per I.S. 1513 : 1986. Gauge Sect. 65 X 40 X 25 Mm Shutter Single Sheet Of 24 Gauge Single Leaf Joinedby Fusion Welding At Appropriate Points With Vertical Grooves Of 15 Mm Wide And 15 Mm Deep At A Distance Of 45 Mm. The First Andlastribshouldbe60mmawayfrom Verticaledgeoftheshutter.Theshuttershallbe Welded, With Angle To From The Periphery Of The Shutter. At The Center Of The Frame There Shall Beangleweldedtobifurcatetheframeintosegmentswithtwoleaf Shuttersquare12mm Square Guard Bars At 120 Mm Center With All Accessories 901 Providingandfixinginpositionfactorymadeboxtypesteelwindowwithglazedfanlight Including Steel Windows Of Cold Rolled Section Of 105Mm X 60Mm X 1.25Mmthick Framesectionfilledwith Cementconcrete ( 1:2:4 ) Andmetalpressedsteelshuttersof20gauge ( 1Mm ) Asperdetailed Drawingand Design Oras Directedincluding Providing Horizontal Mildsteel 12Mm Square Bars At 10Cm Center To Center, Required F7b Section, Section 76, Section 20Mm X 5Mmmildsteelflatforshutterandf4bsectionfor Frame, 3Mm Thick Glass Of Approvedqualityforfanlightnecessaryfixturesandfasteningetc.Complete Finishing With One Coat Of Anticorrosive Paint Etc.Complete 902 Providingandfixinginpositionfactory Madeboxtypefully Glazedwindowconsistingof Coldrolled Sectionof105mmx60mmx1.25Mmthickframesectionfilledwithcement Concrete ( 1:2:4 ) And Steel Section F4b As Per Detailed Drawing And Design Including Mild Steel 12Mmsquarebarsat10cmcenterto Center, Required F7bsection, Sectiont6, Sectionfor Shutter Frame ( Louvered Clips In Case Of Louvered Window Portion ) And 3Mm Thick Glass Of Approved Quality Of Necessaryfixtures And Fastening, Finishing With One Coat Of Anticorrosive Paint Etc. Complete . 903 Providing And Fixing Rolling Shutter Fabricated From Steel Laths Of Minimum Thickness 0.9 Mm With Lock Plate Of 3.15 Mm Thickness Reinforced With 35 X 35 X 5 Mm Angle Section Fitted With Sliding Bolts And Handles For Both Sides, Deep M.S. Channel Section Of Depth And Thickness Not Less Than 65 Mm And 3.15 Mm Respectively With Hold Fast Arrangements, M.S. Bracket Plate 300 X 300 X 3.15 Mm Minimum Size And Shape With Square Bar, Suspension Shaft Of Minimum 32 Mm Diameter, Hood Cover Of M.S. Sheet Not Less Than 0.9 Mm Thickness And Of Any Size At Top And Safety Devices Including Mechanical Gear Operation Arrangement Consisting Of Worm Gear Wheels And Worms Of High Grade Cast Iron Or Mild Steel And One Coat Of Red Lead Primer Etc. Complete. ( I.S. 62481979 ) ( Without Mechanical Gear ) 904 Providing And Fixing Rolling Shutter Fabricated From Steel Laths Of Minimum Thickness 0.9 Mm With Lock Plate Of 3.15 Mm Thickness Reinforced With 35 X 35 X 5 Mm Angle Section Fitted With Sliding Bolts And Handles For Both Sides, Deep M.S. Channel Section Of Depth And Thickness Not Less Than 65 Mm And 3.15 Mm Respectively With Hold Fast Arrangements, M.S. Bracket Plate 300 X 300 X 3.15 Mm Minimum Size And Shape With Square Bar, Suspension Shaft Of Minimum 32 Mm Diameter, Hood Cover Of M.S. Sheet Not Less Than 0.9 Mm Thickness And Of Any Size At Top And Safety Devices Including Mechanical Gear Operation Arrangement Consisting Of Worm Gear Wheels And Worms Of High Grade Cast Iron Or Mild Steel And One Coat Of Red Lead Primer Etc. Complete. ( I.S. 62481979 ) ( With Mechanical Gear ) 905 Providing And Fixing Collapsible Steel Gate In One / Two Leaves With Hot Rolled Vertical Channels Of 18 X 9 X 3 Mm Minimum Size, Crossings Of M.S. Flats Of Size 18 X 5 Mm T Or E Section For Runner Of Minimum 40 X 6 Mm Size For Flange, M.S. Flat For Top Runner Of Minimum Size 40 X 12Mmwithrollerwheelsconfirmingto Gradef.G.150Fittedwithsnapheadedrivetsof Minimum Size 6 Mm Max. Spacing Of Vertical Channels Be 100 Mm Enclosed Gate Position And Clearspaceof150mmbetweentwosetsofcrossingswithhold Fasts, Stoppers, Spaces, Handles, Locking Arrangement Andone Coat Of Redleadprimer Andoil Painting Etc. Complete. ( I.S. 105211983 ) . 906 Providingandfixingpartitionofweldedmeshof3mm Dia.Wires50mm X25mmsizemeshincluding Integratednonteak Seasoned Woodframe 80X 50Mm Ofvertical Andhorizontal Scantling And Finishingwith Oil Painting 3 Coats Etc. Complete 907 Providing And Fixing Sheet Glass Of 24 Oz. For All Size Including Putty Etc. Complete 908 Providing And Fixing Steel Ventilator Fully Glazed Partly Fixed As Per Detailed Drawing Without Hotdipzinc Coatingincluding Fabricatingglazing Withplain / Obscuredglasspanes5mm Thick And Approved Type And Quality And Iron Oxidized Fixtures And Fastening Oil Paint 2 Coats Etc. Complete. 909 Providingandfixingsteelventilatorfullyglazedpartlyfixedasperdetaileddrawingwithhotdip Zinc Coatingincludingfabricatingglazingwith Plain / Obscured Glasspans 5Mmthickandapprovedtype Quality And Iron Oxidized Fixtures And Fastening With Guard Square Bars 12 Mm 10 Cm C / C And Oil Painting 2Coats Etc. Complete. 910 Providingandfixingm.S.Grilldoor24kilogram / Squaremetreofvarioussizeasperdetaileddrawingswithout Hot Dip Coatingiron Fixtures And Fastenings And 3 Coats Of Oil Painting Etc 911 Providingandfixingcctwbeadingofsize40mmx20mmtothedoorframe Includingchamferingfinishing With 3 Coats Of Oil Painting Etc. Complete 912 Providing And Fixing Steel Frame Of Angle 50 X 50 X 6 Mm Size For Window With 16 Mm With Mild Steel Bars Horizontally At 10 Cm C / C For Ventilator Portion And At 15 Cm C / C For Remaining Portion With M.S. Flat Of Size 40 X 6 Mm Vertical At Center Including Iron Hold Fast Boxes For Fixing40x6mmverticalatcenterincluding Iron Hold Fastboxes For Fixing40 X 6 Mm Verticalat Centerincluding Ironholdfastboxes Forfixing Shutters Including Welding Finishing Painting Etc. Complete. 913 Providing And Fixing Steel Frame Of Angle 40 X 40 X 5 Mm Size For Windows With 16 Mm Dia. Mild Steel Bars Horizontally At 10 Cm C / C For Ventilator Portion And 15 Cm C / C For Remaining Portion With M.S. Flat Of Size 40 X 6 Mm Vertical At Center Including Iron Hold Fast Boxes For Fixing 40 X 6 Mm Vertical At Center Including Iron Hold Fast Boxes For Fixing Shutters Including Welding Finishing Painting Etc. Complete. 914 Providing And Fixing Steel Frame Door Of Angle 50 X 50 X 6 Mm With Mild Steel Bars 16 Mm Dia. Horizontally At10mm C / C For Ventilator Portion Including Iron Hold Fast Boxes For Fixing Shutters Including Welding, Finishing, Painting Etc. Complete. 915 Providing And Fixing Steel Frame Door Of Angle 40 X 40 X 5 Mm With 16 Mm Dia. Mild Steel Barshorizontally At10cmc / Cforventilatorportionincludingironholdfastforthefixing Shuttersincluding Welding, Painting, Finishing Etc. Complete. 916 Providing Andfixing Inposition. ( Asperi.S.1868 / 1982 ) Aluminium Sliding Windowoftwo Tracks With Rectangularpipe Having Overalldimension63.50X38.10X1.02Mm Atweight 0.547 Kilogram / Running Metre. And Window Frame Bottom Track Section 61.85 X 31.75 X 1.20 Mm Atweight0.695Kilogram / Running Metre.Topandside Track Section61.85X31.75X 1.30 Mm At Weight 0.659 Kilogram / Running Metre. The Shuttershouldbeofbearingbottom40x18x1.25Mmatweight0.417Kilogram / Runningmetre.Inter Locking Section 40 X 18 X 1.10 Mm At Weight 0.469 Kilogram / Running Metre. And Handle Section 40 X 18 X1.25Mmatweight0.417Kilogram / Runningmetre.Andtopsection40x18x1.25Mmatweight0.417 Kilogram / Running Metre. As Per Detailed Drawings And As Directed By Engineer In Chargewithall Necessary Aluminium Sections Fixtures And Fastenings Such As Roller Bearing In Nylon Casting And Self Locking Catch Fitted In Vertical Section Of Shutter Including 5 Mm Thick Plain Glass With All Required Screws And Nuts Etc, Complete. With Colour Anodising With Box. 917 Providing Andfixing Inposition. ( Asperi.S.1868 / 1982 ) Aluminium Sliding Windowoftwo Tracks With Rectangularpipe Having Overalldimension63.50X38.10X1.02Mm Atweight0.547 Kilogram / Running Metre. And Window Frame Bottom Track Section 61.85 X 31.75 X 1.20 Mm Atweight 0.695Kilogram / Running Metre.Topandside Track Section61.85X31.75X1.30 Mm At Weight 0.659 Kilogram / Running Metre. Theshuttershouldbeofbearingbottom40x18x1.25Mm Atweight0.417Kilogram / Runningmetre. Inter Locking Section40x18x1.10Mm Atweight0.469Kilogram / Runningmetre. Andhandle Section40 X 18 X1.25Mm At Weight0.417Kilogram / Running Metre. Andtop Section40x18x1.25Mmatweight0.417Kilogram / Runningmetre.Asperdetailed Drawingsandasdirectedbyengineerinchargewith All Necessary Aluminiumsectionsfixturesandfasteningssuchasroller Bearing Innyloncasting Andself Locking Catch Fitted In Vertical Section Of Shutter Including 5 Mm Thick Plain Glass With All Required Screws And Nuts Etc, Complete. With Colour Anodising Without Box 918 Providing Andfixing Inposition. ( Asperi.S.1868 / 1982 ) Aluminium Sliding Windowoftwo Tracks With Rectangularpipe Having Overalldimension63.50X38.10X1.02Mm Atweight0.547 Kilogram / Running Metre. And Window Frame Bottom Track Section 61.85 X 31.75 X 1.20 Mm Atweight 0.695Kilogram / Running Metre.Topandside Track Section61.85X31.75X1.30 Mm At Weight 0.659 Kilogram / Running Metre. The Shutter Should Be Of Bearing Bottom 40 X 18 X 1.25 Mm At Weight 0.417 Kilogram / Running Metre. Inter Locking Section 40 X 18 X1.10 Mm At Weight 0.469 Kilogram / Running Metre. And Handle Section 40 X 18 X 1.25 Mm At Weight 0.417 Kilogram / Running Metre. And Top Section 40 X 18 X 1.25 Mm At Weight 0.417 Kilogram / Runningmetre.As Per Detailed Drawings And As Directed By Engineer In Chargewithallnecessaryaluminiumsections Fixtures And Fastenings Such As Roller Bearing In Nylon Casting And Self Locking Catch Fitted In Vertical Section Ofshutterincluding 5Mm Thickplainglasswithallrequiredscrewsandnutsetc, Complete.Withpowder 919 Providingandfixinginposition. ( Asperi.S.1868 / 1982 ) Aluminiumslidingwindowoftwotrackswith Rectangular Pipe Having Overall Dimension ?63.50 X 38.10 X 1.02 Mm At Weight0.547 Kilogram / Running Metre. And Window Frame Bottom Track Section 61.85 X 31.75 X 1.20 Mm Atweight 0.695Kilogram / Running Metre.Topandside Track Section61.85X31.75X1.30 Mm At Weight 0.659 Kilogram / Running Metre. The Shutter Should Be Of Bearing Bottom 40 X 18 X 1.25 Mm At Weight 0.417 Kilogram / Running Metre. Inter Locking Section 40 X 18 X1.10 Mm At Weight 0.469 Kilogram / Running Metre. And Handle Section 40 X 18 X 1.25 Mm At Weight 0.417 Kilogram / Running Metre. And Top Section 40 X 18 X 1.25 Mm At Weight 0.417 Kilogram / Runningmetre.As Per Detailed Drawings And As Directed By Engineer In Chargewithallnecessaryaluminiumsections Fixtures And Fastenings Such As Roller Bearing In Nylon Casting And Self Locking Catch Fitted In Vertical Section Ofshutterincluding 5Mm Thickplainglasswithallrequiredscrewsandnutsetc, Complete.Withpowder 920 Providingand Fixinginposition ( Asper1868 / 1982 ) Alluminiumslidingwindowofthreetrackswith Rectangularpipe 95X38.10X0.90Mm Atweight0.637Kilogram / Running Metre.Withwindowframe Bottom Track Section 92 X 31.75 X 1.30 Mm At Weight 1.070 Kilogram / Running Metre.. Top And Side Track Section 92 X 31.75 X 1.30 Mm At Weight 0.933 Kilogram / Runningmetre.Theshuttershouldbe Ofbearingbottom40x18x1.25Mmat Weight 0.417Kilogram / Running Metre.Inter Locking Section40x 18X 1.10Mm Atweight0.469Kilogram / Runningmetre.Andhandleandtopsection40x18x1.25Mm Atweighto.417 Kilogram / Runningmetre.Asperdetailed Drawings And Asdirected By Engineerinchargewithallnecessaryaluminiumsectionsfixturesandfasteningssuchasrollerbearingin Nylon Casting And Self Locking Catch Fitted In Vertical Section Of Shutter Including 5 Mmthickplainglassand Aluminiummosquitonetshutterwithstainlesssteeljailwithall Required Screws And Nuts Etc, Complete. With L Adi H B 921 Providing Andfixing Inposition ( Asper1868 / 1982 ) Aluminium Sliding Windowofthree Tracks With Rectangularpipe95x38.10X0.90Mm Atweight0.637Kilogram / Runningmetre.Withwindowframe Bottomtrack Section 92 X 31.75 X 1.30 Mmat Weight1.070 Kilogram / Running Metre.. Top And Side Track Section 92 X 31.75 X 1.30 Mm At Weight 0.933 Kilogram / Runningmetre.Theshuttershouldbe Ofbearingbottom40x18x1.25Mmat Weight 0.417Kilogram / Running Metre.Inter Locking Section40x 18X 1.10Mm Atweight0.469Kilogram / Runningmetre.Andhandleandtopsection40x18x1.25Mm Atweighto.417 Kilogram / Runningmetre.Asperdetailed Drawings And Asdirected By Engineerinchargewithallnecessaryaluminiumsectionsfixturesandfasteningssuchasrollerbearingin Nylon Casting And Self Locking Catch Fitted In Vertical Section Of Shutter Including 5 Mmthickplainglassand Aluminiummosquitonetshutterwithstainlesssteeljailwithall Required Screws And Nuts Etc, Complete. With Colour Anodising Without Box 922 Providing Andfixing Inposition ( Asper1868 / 1982 ) Aluminium Sliding Windowofthree Tracks With Rectangularpipe 95X38.10X0.90Mm Atweight0.637Kilogram / Running Metre.Withwindowframe Bottom Track Section 92 X 31.75 X 1.30 Mm At Weight 1.070 Kilogram / Running Metre.. Top And Side Track Section 92 X 31.75 X 1.30 Mm At Weight 0.933 Kilogram / Runningmetre.Theshuttershouldbe Ofbearingbottom40x18x1.25Mmat Weight 0.417Kilogram / Running Metre.Inter Locking Section40x 18X 1.10Mm Atweight0.469Kilogram / Runningmetre.Andhandleandtopsection40x18x1.25Mm Atweighto.417 Kilogram / Runningmetre.Asperdetailed Drawings And Asdirected By Engineerinchargewithallnecessaryaluminiumsectionsfixturesandfasteningssuchasrollerbearingin Nylon Casting And Self Locking Catch Fitted In Vertical Section Of Shutter Including 5 Mmthickplainglassand Aluminiummosquitonetshutterwithstainlesssteeljailwithall Required Screws And Nuts Etc, Complete. With Powder Coating With Box 923 Providing Andfixing Inposition ( Asper1868 / 1982 ) Aluminium Sliding Windowofthree Tracks With Rectangularpipe 95X38.10X0.90Mm Atweight0.637Kilogram / Running Metre.Withwindowframe Bottom Track Section 92 X 31.75 X 1.30 Mm At Weight 1.070 Kilogram / Running Metre.. Top And Side Track Section 92 X 31.75 X 1.30 Mm At Weight 0.933 Kilogram / Runningmetre.Theshuttershouldbe Ofbearingbottom40x18x1.25Mmat Weight 0.417Kilogram / Running Metre.Inter Locking Section40x 18X 1.10Mm Atweight0.469Kilogram / Runningmetre.Andhandleandtopsection40x18x1.25Mm Atweighto.417 Kilogram / Runningmetre.Asperdetailed Drawings And Asdirected By Engineerinchargewithallnecessaryaluminiumsectionsfixturesandfasteningssuchasrollerbearingin Nylon Casting And Self Locking Catch Fitted In Vertical Section Of Shutter Including 5 Mmthickplainglassand Aluminiummosquitonetshutterwithstainlesssteeljailwithall Required Screws And Nuts Etc, Complete. With Powder Coating Without Box 924 A ) Supplyingandfixinginposition Aluminiumfourtrackslidingwindowswithouterframe Made Fromsectionofoverallsize122mmx45mm, Bottomsectionwithdrainsectiontrackweighing 1.83Kilogramper Metre Andtop Andside Section Of Size 122X 31.75 Mm Weighing 1.15Kilogramper Running Metre With Shutter Sections Made Of 18 Mm X 40 Mm Size Having Average Weight Of 0.6Kilogramper Running Metre ( Or As Required Size ) With Change In Proportionate Weight, With 6 Mm Float Glass In Three Equal Panels Andalluminiumcoatedstainless Steel Mosquito Net In One ( 2 / 3Of Opening ) Panel Fixedwith New Neoprene Gasket, Shutters To Be Provided With Nylon Encased Stainless Steel Rollers, Necessary Locks And Handleslt A ) Colour Anodized 925 A ) Supplyingandfixinginposition Aluminiumfourtrackslidingwindowswithouterframe Made Fromsectionofoverallsize122mmx45mm, Bottomsectionwithdrainsectiontrackweighing 1.83Kilogramper Metre Andtop Andside Section Of Size 122X 31.75 Mm Weighing 1.15Kilogramper Running Metre With Shutter Sections Made Of 18 Mm X 40 Mm Size Having Average Weight Of 0.6Kilogramper Running Metre ( Or As Required Size ) With Change In Proportionate Weight, With 6 Mm Float Glass In Three Equal Panels Andalluminiumcoatedstainless Steel Mosquito Net In One ( 2 / 3Of Opening ) Panel Fixedwith New Neoprene Gasket, Shutters To Be Provided With Nylon Encased Stainless Steel Rollers, Necessary Locks And Handleslt B ) Powder Coated 926 Providingandfixing30mmthickbothsideprelaminatedsolidpanelpvcdoor Shutter Consisting Of Frame Made Out Of M.S Tubes Of 19 Guage Thickness And, Size 19 X 19 Mm For Styles And 15 X15 Mm For The Top And Bottom Rails, M.S Frame Shall Have A Coatofmetelprimerof Approvedmake Andmanufacture. M.Sframe Shallbe Coveredwith Heat Mouled Pvc C Channel Made From 5 Mm ( + / 0.25 ) Thickprelaminatedsheetof Density600kilogram / Cbm , Of Size 30Mm Thickness70mm Widthout Ofwhich 50Mm Shall Be Flat And 20Mm Shall Be Tapered In 45? Angle On Either Side Forming Stiles;And5 Mm Thick , 95 Mm Wide Pvc Sheet Out Of Which 75 Mm Shall Be Falt And 20 Mm Shall Be Tapered In 45 On The Inner Side To Form Top And Bottom Rail And 115 Mm Wide Pvc Sheet Out Of Which 75 Mm Shall Be Falt And 20 Mm Shall Be Tapered On Both Sides To Form Lock Rail.Top, Bottom And Lock Rail Shall Be Provided Either Side Of The Panel. An Additional 5 Mm ( + / 0.25 ) Thick Pvc Strip Of 20 Mm Width Is To Be Stuck On The Bottom Side Of The C Channel Prelaminated Paneling Of 5 Mm ( + / 0.25 ) Thick Pvc Sheet To Be Fitted Inside The M.S. Frame Welded / Sealed To The Styles And Rails With 5 Mm ( + / 0.25 ) X 30 Mm Pvc Sheet Beading On Either Side And Joined Together With Solvent Cement Adhesive Etc , 10 Mm Thickness ( 5 Mm ( + / 0.25 ) X 2 Nos ) 20 Mm Wide Cross Pvc Sheet As Gap 927 Providing And Fixing 34 Mm Thick Moulded Door Shutter Consisting Of Solid Core Single Leaf Flush Door Of 30 Mm Thickness Lipped With 15 Mm ( 5Mm X 3 ) Thick X 30 Mm Width On One Style And Top Rail And 10 Mm ( 5Mm X 2 ) Thick X 30 Mm Width On Other Style And Bottom Rails. Theinnerpanelslaminatedwith2mmthick Termiteproof, Waterproofandfireresistant Mouldedpvc Sheet With2, 4, 6 Design In Different Plainand / Or Prelim Colours On One Side After Routing The Moulded Design On Flush Doors And 2 Mm Plain And / Or Pre Lam Pvc On Other Side Using Rubber Adhesive On Flush Door And Solvent Cement Adhesive On The Pvc Lipping Etc. Asperdirectionofengineerinchargeandmanufacturersspecificationanddrawingetc. Complete. 928 Providingandfixingcoldrolledsteelhollowdoorframe105mmx60mmforanysizes Including Hold Fasthinges, Tie Members Withredoxide Andgray Paint Etc.Complete Asperi.S.I.Specificationsandcodeofpracticeprescribedincludinganticorrosivetreatmentas Directed By Theengineer. 929 Providingandfixinginpositionaluminiumopenablewindowofanysizeasperdetailed Drawingand Asdirected Byengineerin Chargewith Allnecessaryaluminumsections Including Necessary Fixtures And Fastening With 5 Mm Thick Clear Float Glass Etc. Complete. A ) With Colour Anodizing Notewhilearriving Attherateofitemofitemweightat6.90 Kilogram / Square Metre Is Considered. 930 Providingandfixinginpositionaluminiumopenablewindowofanysizeasperdetaileddrawingandasdirectedbyengineerinchargewithallnecessaryalluminiumsectionsincludingnecessaryfixturesand Fastening With 5 Mm Thick Clear Float Glass Etccomplete A ) Colour Anodized 931 Providingandfixinginpositionaluminiumopenablewindowofanysizeasperdetaileddrawingandasdirectedbyengineerinchargewithallnecessaryalluminiumsectionsincludingnecessaryfixturesand Fastening With 5 Mm Thick Clear Float Glass Etccomplete B ) Powder Coated 932 Providing And Fixingin Position Aluminiumfixed Window Fully Glazed Of Any Sizeasperdetailed Drawingandasdirectedbyengineerinchargewithallnecessaryalluminiumsectionsincludingnecessary Fixtures And Fastening Such As 5 Mm Thick Clear Float Glass Etc. Complete.Note While Arriving Atthe Rateofitem Ofitem Weightat6.90 Kilogram / Square Metre Is Considered. A ) Colour Anodized 933 Providing And Fixingin Position Aluminiumfixed Window Fully Glazed Of Any Sizeasperdetailed Drawingandasdirectedbyengineerinchargewithallnecessaryalluminiumsectionsincludingnecessary Fixtures And Fastening Such As 5 Mm Thick Clear Float Glass Etc. Complete.Note While Arriving Atthe Rateofitem Ofitem Weightat6.90 Kilogram / Square Metre Is Considered.B ) Powder Coated 934 Providing And Fixing In Positionaluminium Fixed Window Fully Glazed Of Any Size As Per Detaileddrawing And Asdirectedbyengineerinchargewith Allnecessaryalluminiumsectionsincludingnecessaryfixturesandfastening Such As 5 Mm Thick Clear Float Glass Etc. Complete. A ) Colour Anodized 935 Providing And Fixing In Positionaluminium Fixed Window Fully Glazed Of Any Size As Per Detaileddrawing And Asdirectedbyengineerinchargewith Allnecessaryalluminiumsectionsincludingnecessaryfixturesandfastening Such As 5 Mm Thick Clear Float Glass Etc. Complete. B ) Powder Coated 936 Providingandfixinginpositionaluminiumpartlyopenableandpartlyfixedwindowofanysize As Per Detaileddrawingandasdirectedbyengineerinchargewithallnecessary Alluminium Sections Including Necessary Fixtures Andfastening With5 Mm Thick Floatglass Etc.Complete.A ) With Colour Anodizingnote Whilearrivingattherateofitemofitem Weight At 6.90 Kilogram / Square Metre Is Considered. 937 Providingandfixinginpositionaluminiumpartlyopenableandpartlyfixedwindowofanysize As Per Detaileddrawingandasdirectedbyengineerinchargewithallnecessary Alluminium Sections Including Necessary Fixtures And Fastening With 5 Mm Thick Float Glass Etc. Complete.B ) With Powder Coating Note While Arriving At The Rate Of Item Of Item Weight At 6.90 Kilogram / Square Metreis Considered. 938 Providingandfixingm40gradethickvibratedpullcastorsimilartypeconcreteframewithchamfer Conforming To I.S. 65241983 Having 6 Mm Dia. Bars 3 Nos. And Stirrups @250 Mm C / Candfixing Inwall With 6 Nos Of Hold Fast Of 12 Mmdia Bars 500 Mmlong Includingprimerandoilpaintingetc, Complete ) Frame Size 60 Mm X 100 Mm . 939 Providingandfixingm40gradethickvibratedpullcastorsimilartypeconcreteframewithchamfer Conforming To I.S. 65241983 Having 6 Mm Dia Bars 3 Nos. And Strips @250 Mm C / C And Fixing In Wall With 6 Nos. Of Hold Fast Of 12 Mm Dia Bars 500 Mm Long Including Primer And Oil Painting Etc, Complete ) Frame Size60 Mm X 125 Mm 940 Providingandfixingfiberglassreinforcedpolysterdoorshutter30mmthickasperis14856 ( 2000 ) ( Reaffirmed 2006 ) Withoutventilatorincluding Chromiumplatedfixturesandfasteningwith Chromium Plated Handles On Both Sides, Etccomplete 941 Providingandfixingfiberglassreinforcedpolysterdoorshutter35mmthickasperis14856 ( 2000 ) ( Reaffirmed 2006 ) Withoutventilatorincluding Chromiumplatedfixturesandfasteningwith Chromium Plated Handles On Both Sides, Etclt 942 Providingandfixingacrylicplasticsheetpanelsofapprovedqualityinrequiredthickness Plain Clearor Any Colour Or Obscured Linings In Lieu Of Glass Pans To Doors / Windows Including Providing And Fixing Clips, Putty Etc. Complete. ( A ) 2.00 Mm Thick. 943 Providingandfixingacrylicplasticsheetpanelsofapprovedqualityinrequiredthickness Plain Clearor Any Colour Or Obscured Linings In Lieu Of Glass Pans To Doors / Windows Including Providing And Fixing Clips, Putty Etc. Complete. ( B ) 3.00 Mm Thick. 944 Providing Andfixing 24 Gauge Plainaluminium Sheet On The Face Of Door Shutter Including Cutting To Required Size And Fixing The Screws Including Making Good The Damages If Any To Existing Door Shutter And Frame Etc.Complete As Directed Or As Per Detailed Drawing 945 Providingandfixinginposition, Doubleshutteredaluminiumextrudedpowdercoated Openable Door Of Specified Size With Aluminium Door Frame Of Powder Coated Section 101.60 X 44.75Mm , 3.18Mm Thickand Shuttercomprising Ofpowder Coatedsection Having Bottom And Lock Rail Of Size 150 Mm X 44.5 Mm X 3.00 Mm Thick Top Rails 47.62 X 44.45 Mm X 3.00 Mm Thick , Vertical Style 47.62 X 44.45 Mm, 3.00 Mm Thick And For Shutter Plain Glass Panes 5 Mm Thick For Top Panels And 12Mm Thick Both Side Laminated Phenol Bonded Particle Board Panels For Bottompanels Etc. , I.S.I. Mark , Heavy Duty, Hydraulic Floorspringof 150Kilogramcapacity , Having Heavy Duty Concealedlock, Necessary Beading, Glazing Clips, Pvc Gaskets, 250Mm Length Aluminium Tower Bolts, 150Mm Dia. Pad Handle, Etc. As Perdetailed Design And Drawing Or As Directed By Engineer In Charge Including All Materials , Labours, Andequipment Etc.Complete 946 Providingandfixinginposition, Singleshutteredaluminiumextrudedpowdercoated Openable Door Of Overall Size 0.90 M X 2.40 M With Aluminium Door Frame Of Powder Coated Section 101.60 X 44.75Mm , 3.18 Mm Thick And Shutter Comprising Of Powder Coated Section Having Bottom Andlock Rail Of Size 150 Mm X 44.5 Mm X 3.00 Mm Thick Top Rails 47.62X 44.45 Mm X 3.00 Mm Thick , Vertical Style 47.62 X 44.45 Mm, 3.00 Mm Thickandforshutterplain Glass Panes 5 Mm Thick For Top Panels And 12Mm Thick Both Side Laminated Phenol Bonded Particle Board Panels For Bottom Panels Etc. , I.S.I. Mark , Heavy Duty, Hydraulic Floorspring Of 150Kilogramcapacity , Having Heavyduty Concealed Lock, Necessarybeading, Glazing Clips, Pvcgaskets, 250Mm Lengthtower Bolts, 150Mm Diam. Padhandle, Etc. As Per Detaileddesign And Drawing Or As Directed By Engineer In Charge Including All Materials , Labours, Andequipment Etc.Complete 947 Providingandfixinginposition, Singleshutteredaluminiumextrudedpowdercoated Openable Door Of Overall Size 0.90 M X 2.40 M With Aluminium Door Frame Of Powder Coated Section 101.60 X 44.75Mm , 3.18 Mm Thick And Shutter Comprising Of Powder Coated Section Having Bottom Andlock Rail Of Size 150 Mm X 44.5 Mm X 3.00 Mm Thick Top Rails 47.62X 44.45 Mm X 3.00 Mm Thick , Vertical Style 47.62 X 44.45 Mm, 3.00 Mm Thickandforshutterplain Glass Panes 5 Mm Thick For Top Panels And 12Mm Thick Both Side Laminatedphenol Bonded Particle Board Panels For Bottom Panels Etc. , I.S.I. Mark , With Bijagiri Having Heavy Duty Concealed Lock, Necessary Beading, Glazing Clips, Pvc Gaskets, 250Mm Length Towerbolts, 150Mmdiam.Padhandle, Etc.Asperdetaileddesignanddrawingorasdirectedby Engineer In Charge Including All Materials , Labours, And Equipment Etc. Complete 948 Providing And Fixing 50 Mm X 50 Mm Mild Steel Square Pipe Framed Steel Windows Of Various Sizes As Per Details With Welded Square Bars 12 Mm At 10 Cm Center To Center Without Hot Dip Zinccoatingwithout / With Ventilatorincludingfabrication, Glazingwithplain / Obscured Glass Panes 5 Mm Thickof Approved Type And Quality, All Fixtures And Fastenings And Finishing With One Coat Of Primer Complete. 949 Providing Andfixing Inposition Powder Coated Aluminium Louvered Windows / Ventilator Of Varioussizes Withpowdercoatingasperdetaileddrawingandspecificationsincluding Aluminiumframes80x38 Mmx1.22Mmboxtype, 5Mmthicksheetglasslouvers, Of Approved Quality Etc. Complete. 950 Providing And Fixing Partitions Made Up Of Cctw Frame Of Size 75 Mm X 50 Mm At 60 Cm C / C With 9 Mm Thick Commercial Ply And 4Mm Thick Veneer On Both Sides With French Polish Etc. Complete. 951 Providing And Fixing Country Cut Teak Wood Partly Veneered And Partly Glazed Partition With 75Mmx50 Mmframeat60cmcenterand9mmthickcommercialplyonbothsides, Decorative Veneer Of 4 Mm Thick And Plain Glass 5 Mm Thick, Including French Polishing Etc.Complete 952 Providing And Fixing Welded Mesh Of 50 Mm X 25 Mm And ( 11 Gauge ) To Country Cut Teak Woodframework Asperdetaileddrawingorasdirected, Ironfasteningwithonecoatof Primer, Scaffolding, Including Tw Frame Work Of 70 Mm X 75 Mm And Covering Cctw Battens Of 45 Mm X 10 Mm Etc. Complete. 953 Providng And Fixing In Position Anodised Extruded Aluminum Partitions, Partly Glazed Andpartly Laminated Having Frame Made Out Of Extruded Tubular Section Of Size 40 Mm X 60 Mm With 12 Mm Thick Three Layeredflatpressedteakwoodparticleboardbondedwithbwptypeexteriorgradephenolformaldehyde Synthetic Resin Conforming To Is 128231990, Laminated On Both Sides, Novateakor Equivalent And 5 Mm Thick Selected Quality Plain / Float Glass Panels Fixedwithaluminum Glassclips12mm X12mm Andrubber Cushioningbeadingtoglass Partitions As Per Approved Drawing Etc. Compete 954 Providing And Fixingin Position Extruded Aluminiumpartitions Having Framemade Out Ofextruded Tubular Section Of Size 65 Mm X 40 Mm With 12 Mm Thick Three Layered Flat Pressed Teak Woodparticleboard Bonded With Bwp Type Exterior Grade Phenol Formaldehyde Syntheticresin Conforming To Is 129231990, Laminatedonbothsides, Novateakorequivalentwith Aluminium Glazing Clips Of Size 12 Mmx 12 Mm ( Onical ) As Per Drawing Etccomplete 955 Providing And Fixing Fly Proof Mesh Shutter Toventilator / Window Using Cctw Members Of Size 45 X22 Mm For Frame Work And35 X 22 Mm For Middle Support Andfixing Fly Proof Mesh On It And Coveringtw Battens Of Size 20 X 10 Mm Including Priming And Two Coats Of Oil Painting To The New Wood And Steel Work And All Labour Charges Including All Fixture And Fastenings Etc. Complete 956 Providingcoloured Anodisingtreatmenttoaluminiumsectionsof Thedoors , Windows, Andventilators Including All The Intermediate Supports , Side Supports, Screws Andall The Necessary Fixtureswithallleads, Lifts, Fixing Charges Etc. Complete ( Complete Measurement On Actual Square Meter Basis Of Opening Area Shallbe Paid ) 957 Providingandfixingaluminiumgrilldiamondmeshtypedg202of7.5Mmthickincludingfixing In Positionanodisedaluminium Framesectionof80x38mm X1.22Mm Sizebox, Cutting To The Requiredsize With All Wastage Labourlead Lift Etccomplete 958 Providing And Fixing In Position Mild Steel Fixed Staggered ( Z Type ) Ventilator As Perdetailed Drawing With Hot Deep Zink Coating Including Fabricating With Mild Steel Z Section Of Size 20Mm X 25 Mm And 3 Mm Thick At Weight 1.42 Kilogram / Running Metre, With Stainless Steel Mosquito Net Of 304 Grade, 4Mm Thick Float Glass ?Asdirected By Engineer Incharge Including Necessary Welding, Grinding, Two Coats Of Oilpaint Etc Complete 959 Providingandfixinginpositionanodised ( Asperis1868 / 1982 ) Aluminiumfixedstaggered ( Ztype ) Ventilator With Aluminium Rectangular Pipe 63 Mm X 38.10 Mm X 1.22 Mm At Weight 0.650 Kilogram / Running Metre, Aluminium Angle Of Size 15 Mm X 15 Mm X 1 Mm, Aluminium Channelof9mm Sizes, S.S.Mosquito Net Of 304 Grade, 4 Mm Thickfloat Glassper Detaileddrawingandasdirectedbyengineer In Charge Etc Complete 960 Providingandfixingweldedmeshof11gaugewireshavingmeshsize50mmx25mm Includingm.S Angle Frame Of Size 35 Mm X 35 Mm X5 Mm In Position With Oil Painting 3 Coats Etc. Complete 961 Providing And Fixing 32 Mm Thick One Piece Single Moulded Puff Abstrone Butadyne Styrine ( Abs ) Doorshutterforinternaluseincluding Toiletsmade Upof Outerabssheetof1.2 Mmthickhavingpuffinsulationof35to40kilogram / Cubic Metredensity And 10 Mm Dia.For Steel Bars 2 Nos., Wooden Block To Receive Fixtures, Having M.S. Hinges 100 Mm Length, M.S. Handles 150 Mm Length And 10 Mm Dia Sliding Door Bolt Etc. Complete 962 Providingandfixing30mmthick Solidpanelpvcinternaldoorshutter Consisting Of Frame Made Out Of M.S. Tubes Of 19 Gauge Thickness And Size Of 40Mm X 20Mm For Stiles , Top, Lock And Bottom Rails. M.S. Frame Shall Have A Coat Of Steel Primers Of Approved Makeandmanufacture.M.S.Frameshallbe Coveredwith5mmthickheatmolded Pvc Channel Of Size 30 X 100Mm Forming Stiles, And 5Mm Thick, 125Mm Wide Pvc Sheets For Top Rail, Lock Rail And Bottom Rail On Either Side, And15mm ( 5Mm X 3 ) Thick, 20Mm Wide Cross Pvc Sheet As Gap Insert For Top Rail And Bottom Rail. Paneling Of 10 Mm Thick Prelam Pvc Sheet To Be Fitted In The M.S. Frame Welded / Sealed To The Stiles And Rails With 30Mm Wide X 5Mmthickpvc Sheetbeadingoneitherside, Andjoinedtogetherwithsolventcement Adhesive Etc. An Additional 5Mm Thick Pvc Strip Of 20Mm Width Is To Be Stuck On The Interior Side Of The C Channel Using Pvc Solvent Cement Adhesive. Including Stainless Steel Fixtures And Fastening Complete As Per Direction Of Engineerincharge, ManufacturerSspecification And Drawing. 963 Providing Andfixing 30Mm Thick Pvcflushldoorshutterconsisting Ofpanelofhollowpvc Profile Of 20 Mm Thickness Consisting Frame Made Out Of M.S. Tubes Of 19 Gauge Thickness And Size Of 19Mm X 19Mminserted Inside The Hollow Section Of Stiles Rails Top ?And Bottom Railsandtwo19x19mm Mstubes Insertedhorizontallyinsidethe Hollowprofile Section Using 4 / 5 Mm Sheet Using Screws Hollow Profile Shall Be Lipped With 10 Mm ( 5Mm X2 ) Thickx20mmwidthonstilesandrailsusingsolventcement.The Innerpanelshallbe Laminatedwith5mm Thicktermite Proofwaterproof Plain / Prelam Pvcsheet Using Solventcement On The Both Sides Of The Panel Including Stainless Steel Fixtures And Fastening Etc. Complete As Per Direction Of Engineer Incharge, Manufacturers Specification And Drawing. 964 Providingandfixingpartition4mmthickindianteakveneerononesideand6mm Commercial Type Plywoodonthe Other Side Including C.T.W. Frame Of 70X35mm At 60Cm C / Conbothways, Including Finishing With French Polishing To Veneer Face And Oil Painting / French Polishing To Other Face Etc.Complete. ( Without Skirting ) 965 Providing Andfixing Partitions With12mm Thick Three Layeredflatpressedteakwoodparticle Board Both Facescommercial Bonded With Phenol Formal Dehydesyntheticresin Including Ctwvertical 70X70 Mm And Top And Bottom Rail Of 70 X 35 Mm And Covering Batten Of 20 X 10 Mm At 1.00 Metre Apart On Both Ways Or As Directed Including Finishing With One Coat Of Primer Complete. 966 Providing And Fixing Partitions With 12 Mm Thick Three Layerd Flat Pressed Teakwoodcommercial Boardcompressedonefaceandotherteakveneerbondedwithphenolformaldehydesynthetic Resin Including Ctw Vertical 70 X 70 Mm And Top And Bottom Rail Of 70X35mmandcoveringbattenof20x10mmat1.00Metreapartonbothwaysoras Directed Including Finishing With One Coat Of Primercomplete 967 Providing Andfixing Partitionwith12mm Thickthree Layeredflat Pressedveneer Teakwoodparticalboard With Both Faces Teak Veneer Bonded With Phenol Formaldehyde Synthetic Resin Including C.T.W. Vertical 70 X 70 Mm And Top And Bottom Rail Of 70 X 35 Mm And Covering Batternof 20 X 10 Mm At 1.00Metre Apart On Bothways Or As Directed Including Finishing With One Coat Of Primer Complete. 968 Providing And Fixing In Position C.C.T.W. Brackets For Weather Sheds Of Section 70 X 45 Mm Withmortise Andtenonjoineryat1.2To 1.5Metre Centerto Centerorasdirectedandteak Wood Battens Of Required Section, Including Fixing Three Numbers Of Iron Nut And Bolts To Each Bracket, Necessary Scaffolding And Twocoats Of Painting To Wood Work Etc. Complete. 969 Providing And Fixing 22 B.W.G. Plain Galvanised Iron Sheets On Top Of Weather Shed, Including Scaffolding, Fixing By Means Of Nut And Bolts Or As Directed Etc. Complete. ( Brackets Of 70 X 45 Mm To Be Paidseparately ) 970 Providingandfixing22b.W.G.Plainfrpsheetsontopofweathershed, Includingscaffolding, Fixing By Means Of Nut And Bolts Or As Directed Etc. Complete. ( Brackets Of 70 X 45 Mm To Be Paid Separately ) 971 Providing Andfixing 4Mm Thickplaina.C.Sheets ( Ofisstd. ) On Topofthe Weathershedincluding Scaffolding, Fixing By Means Of Nuts And Bolts Or As Directed Etc. Complete As Per Detailed Drawing ( Brackets Of70 X 45 Mm To Be Paid Separately ) 972 Providing And Fixing Country Teak Woodrunner Size 150 X 75 Mm Over Partition, Including Rounding, Fixing In The Masonrywhere Necessary Beading On Sides Etc. Complete. 973 Providing And Fixing Teak Wood Cover Moulding 45 X 20 Mm Over Doors And Windows In The Requiredshape Andsize Asperdrawing, Including Allmouldingsandfinishing Withfrenchpolishing Etc. Complete. 974 Providingandfixingaluminiumgrill` ( 5.13Kilogram / Squaremetre ) Decorativeofvarious Sizes As Per Detail Drawing And Specification Etc. Complete. ( Prior Permission To Be Obtained From S.E. Before Execution Ofthis Item ) ( 5.13 Kilogram / Square Metre ) 975 Providing And Fixing Solid Core Flush Door Shutter In Double Leaf 32 Mm Thick Decorative Type Of Exterior Grade As Per Detailed Drawings Approved Face Veneers 3 Mm Thick On Both Faces Or As Directed, All Necessary Beads, Mouldingsandlipping, Wroughtironholdfasts, Chromiumplated Fixtures And Fastenings, With Brass Mortiselock, Chromiumplatedhandlesonboth Sides, And Finishing With French Polish Etc. Complete. 976 Providing And Fixing Country Teak Wood Four Leafpaneled Shutters, 35 Mm Thick Style And Railand25mm Thickpanelswithoutventilatorasperdetaileddrawingexcluding Thedoor Frame, Stainless Steelfixtures And Fastening And Finishing The Wood Work With Oil Painting 3 Coats Complete 977 Providing Andfixing Mildsteelgrill Workfor Windows, Ventilators Etc.20Kilogram / Square Metre As Per Drawing Including Fixtures, Necessarywelding Andpainting Withone Coatsof Anticorrosive Paint And Twocoats Of Oil Painting Complete. 978 Providing And Fixing Mild Steel Grill Work For Windows, Ventilators, Etc. 15 Kilogram / Square Metreasper Drawingincludingfixturesnecessaryweldingandpaintingwithonecoatof Anticorrosive Paint And Twocoats Of Oil Painting Complete 979 Providing And Fixing Mild Steel Grill Railing 20 Kilogram / Sq.M With Teak Woodhand Rail Of Size75mmx60 Mm.And Sill Of 75Mm.X 25 Mm.And Newel Posts For Staircases, Includingfabricating, Fix-Tures, Erecting, Painting The Grillworkwithone Coatofanti-Corrosivepaint And Two Coats Of Oil Painting With Approved Colour And Polishing The Sill, Hand Rail And The Newel Post With French Polish. 980 Providing And Fixing Mild Steel Grill Railing 15 Kilogram / Sq.M With Ghanateak Wood Hand Rail Of Size 75Mm X 60Mmandsillof75mm.X25mmandnewelpostsforstaircases, Includingfabricating, Fixtures, Erecting, Paintingthegrillworkwithonecoatofanticorrosivepaintandtwocoatsofoilpaintingwithapproved Colours And Polishing The Sill, Hand Rail And The Newel Post With French Polish. 981 Providing And Erecting Y Type Barbed Wire Fencing With Seven Rows Of Wire With 2.45 Mm Diag.I.Pipe ( Rezan / Concentideletedire0.75Mmdia ) Withhotdipandg.I.Coatedhooksasperdrawing Supportedonm.S.Angle50x50x6mmat2.5Mtr.C / Cincludingfixingand Fastening With Wire, Painting M.S. Angles With One Coat Of Red Lead Primer And Two Coat Of Oil Paint Etc. Complete. 982 Providingandfixing40mmdiameterand1.5Mmthickstainlesssteelhandrailingins.S.304Gradeincludingfabricating, Fixtures, Errecting, Necessarywelding, Grinding, Finishing, Buffing To Stainless Steel Pipe Etccomplete 983 Providingandfixing900mmhighs.S.304Grade Stainlesssteelrailingwith40mmdiameterand 1.5Mm Thick At Top, 40Mm Diameter And 1.5Mm Thickvertical Supports Spaced At 1.5M Center Tocenter And 8Mm Thick Toughened Glass Including Fabricating , Fixtures, Errecting , Necessarywelding, Grinding, Finishingbuffing To Stainless Steel Pipe Etc. Complete 984 Providing And Fixing Mat Finish Stainless Steel ( Of 302 Grade ) Railing With Toppipe Of 50 Mm Dia. And Vertical Pipe Of 38 Mm Dia At 0.60 M C / C Or As Required And Horizontal Pipes Of 25 Mm Dia In Three Rows, All Pipes Of 2 Mm Thick Including Buffing, Fabricating Fixtures And Fastening Including Pipe Base Of Appropriate Diameter And Ball Base Of 75 Mm Dia Above Newel Post Of75 Mm Diameter Etc. Complete ( Prior Approval Of Sample And Brand By Ex.Engineer Isnecessarybf ) 985 Providing Andfixing Mild Steel Grill Railing Weighing 15Kilogram / Square Metre. Withteak Woodhandrail Ofsize75mm.X60mm.Andsill75mm.X25mm.Andpostsforverandah Includingfabricating, Fixtures, Erectingandpaintingthegrillworkwithonecoatof Anticorrosive Paint Andtwo Coats Of Oil Paint And Polishing The Grill, Handrail Withfrench Polish. Spec. Number : Bd.U.3 986 Providing Andfixing Mildsteel Grill Railing Weighing 15Kilogram / Square Metre. Withpvc Handrail Cover And Newel Post For Staircases, Including Fabricating, Fixtures, Drilling Holes In Concrete / Other Surface, Erecting Thegrillwork, Necessarywelding, Fixingbynutsandbolts, Fixingpvchandrailcover, Withonecoatof Anticorrosivepaintandtwocoatsofoilpaintingwithapprovedcolourandshade, Remakingthedamaged Surface, Cleaning, Etc. Complete.Spenumbr A Directed By Engineer In Charge 987 Providing Andfixing Mildsteel Grill Railing Weighing 20Kilogram / Square Metre. Withpvc Handrail Cover And Newel Post For Staircases, Including Fabricating, Fixtures, Drilling Holes In Concrete / Other Surface, Erecting Thegrillwork, Necessarywelding, Fixingbynutsandbolts, Fixingpvchandrailcover, Withonecoatof Anticorrosivepaintandtwocoatsofoilpaintingwithapprovedcolourandshade, Remakingthedamaged Surface, Cleaning, Etc. Complete.Sn Ba Di Td B Eii H 988 Providing Andlaying Castironpipesofbclassof 80Mm Diameter Withsockets Andspigot Ends / Flanges Andcastcentrifugally / Verticallyincludingspecials, Layingpipesandback Filling The Trench Completeincluding Excavation. 989 Providing And Laying Cast Iron Pipes Of B Class Of 100Mm Diameter With Sockets And Spigot Ends / Flanges Andcastcentrifugally / Verticallyincludingspecials, Layingpipesandbackfillingthetrenchcompleteincluding Excavation 990 Providing And Laying Cast Iron Pipes Of B Class Of 150Mm Diameter With Sockets And Spiget Ends / Flanges And Cast Centrifugally / Vertically Including Specials, Laying Pipesandbackfilling The Trenchcomplete Includingexcavation 991 Providing And Making Lead Joints For 80Mm Diameter Cast Iron Pipe Line Including Leadand Testing. 992 Providing And Making Lead Joints For 100Mm Diameter Cast Iron Pipes Line Including Lead And Testing. 993 Providing And Making Lead Joints For 150Mm Diameter Cast Iron Pipe Line Including Lead And Testing 994 Providing And Making Flanged Connection For The 80Mm Diameter Cast Iron Pipe Line Including Painting Rubber Insertion, Nuts And Bolts Etc. Complete. 995 Providing And Making Flanged Connection For The 100Mm Diameter Cast Iron Pipe Lineincluding Painting Rubber Insertion, Nuts And Bolts Etc. Complete. 996 Providing And Making Flanged Connection For The 150Mm Diameter Cast Iron Pipe Lineincluding Painting Rubber Insertion, Nuts And Bolts Etc. Complete. 997 Providingandfixingonwalls / Ceiling / Floors, 15Mmdia.Heavygradehavingembossedasisi Mark Galvanised Iron Pipes Weight Of 1.48 Kilogram / Metre With Necessary Fittings.Remakinggoodthe Demolished Portion And Applying Primer Of Anti-Corrosive Oil Paint 2 Coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedtcomplte 998 Providingandfixingonwalls / Ceiling / Floors20mmdia.Heavygradehavingembossedasisimark Galvanised Iron Pipes Of 1.93 Kilogram / Meter With Necessary Fitting Remaking Good The Demolishedportion Andapplyingprimerofanti-Corrosiveoilpaint, 2Coatsincluding Necessaryscaffoldingandremoving Existingpipelineifnecessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc.Complete 999 Providingandfixingonwalls / Ceiling / Floors, 25Mmdia.Heavygradehavingembossedasisi Mark Galvanised Iron Pipes Weight Of 3.01 Kilogram / Meter With Necessary Fittings .Remakinggoodthe Demolished Portion And Applying Primer Of Anti-Corrosive Oil Paint 2 Coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedt Lt 1000 Providingandfixingonwalls / Ceiling / Floors, 32Mmdia.Heavygradehavingembossedasisi Mark Galvanised Iron Pipes Weight Of 3.89 Kilogram / Meter With Necessary Fittings .Remakinggoodthe Demolished Portion And Applying Primer Of Anti-Corrosive Oil Paint 2 Coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedtcomplte 1001 Providingandfixingonwalls / Ceiling / Floors, 40Mmdia.Heavygradehavingembossedasisi Mark Galvanised Iron Pipes Weight Of 4.49 Kilogram / Meter With Necessary Fittings Andremakinggoodthe Demolished Portion And Applying Primer Of Anti-Corrosive Oil Paint 2 Coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedetccomplete 1002 Providingandfixingonwalls / Ceiling / Floors, 50Mmdiaheavygradehavingembossedasisimark Galvanised Iron Pipesweight Of 6.33 Kilogram / Meter With Necessary Fittings.Andremakinggood The Demolishedportionandprimerofanticorrossiveoilpaint2coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedt Lt 1003 Providingandfixingonwalls / Ceiling / Floors, 80Mmdia.Heavygradehavingembossedasisimark Galvanised Ironpipesweightof10.15Kilogram / Meterwithnecessaryfittings.And Remaking Good The Demolished Portion And Applying Primer Of Anti-Corrosive Oil Paint 2 Coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedetc. Complete. 1004 Providingandfixingonwalls / Ceiling / Floors, 100Mmdia.Heavygradehavingembossedasisimark Galvanisedironpipesweightof14.74Kilogram / Meterwithnecessaryfittings.Andremakinggoodthe Demolished Portion And Applying Primer Of Anti-Corrosive Oil Paint 2 Coats Including Necessary Scaffolding And Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directedetccomplete 1005 Providing And Laying In Trenches 15Mm Dia.Medium Gradehaving Embossedasisimark Galvanised Ironpipesof1.25Kilogram / Meternecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimerofanti-Corrosiveoilpaint, 2Coatsincluding Removingexistingpipelineif Necessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1006 Providing Andlaying Intrenches20mm Dia.Medium Gradehaving Embossedasisimark Galvanised Iron Pipes ?Of 1.63Kilogram / Meter Necessary Fitting Remaking Good The Demolished Portion With Filling Trenches And Withprimer Of Anti-Corrosive Oil Paint, 2Coats Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1007 Providing Andlaying Intrenches25mm Dia.Medium Gradehaving Embossedasisimark Galvanised Iron Pipes ?Of 2.49 Kilogram / Meter Necessary Fitting Remaking Good The?Demolishedportionwithfillingtrenchesandwithprimerofanti-Corrosiveoilpaint, 2Coatsincludingremovingexistingpipelineifnecessary And Conveyingand Stackingthesameinpwdchowkyoras Directed Etccomplete 1008 Providingandlayingintrenches32mmdia.Mediumgradehavingembossedasisimark Galvanised Iron Pipes ?Of 3.20Kilogram / Meter Necessary Fitting Remaking Good The Demolished Portion With Filling Trenches And Withprimer Of Anti-Corrosive Oil Paint, 2Coats Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1009 Providing Andlaying Intrenches40mm Dia.Medium Gradehaving Embossedasisimark Galvanised Iron Pipes ?Of 3.68Kilogram / Meter Necessary Fitting Remaking Good The Demolished Portion With Filling Trenches And Withprimer Of Anti-Corrosive Oil Paint, 2Coats Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1010 Providing Andlaying Intrenches50mm Dia.Medium Gradehaving Embossedasisimark Galvanised Iron Pipes ?Of 5.17Kilogram / Meter Necessary Fitting Remaking Good The Demolished Portion With Filling Trenches And Withprimer Of Anti-Corrosive Oil Paint, 2Coats Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1011 Providing Andlaying Intrenches80mm Dia.Medium Gradehaving Embossedasisimark Galvanised Iron Pipes ?Of 8.57Kilogram / Meter Necessary Fitting Remaking Good The Demolished Portion With Filling Trenches And Withprimer Of Anti-Corrosive Oil Paint, 2Coats Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1012 Providing And Laying In Trenches 100 Mm Dia. Medium Grade Having Embossed As Isi Mark Galvanised Iron Pipes ?Of 12.43 Kilogram / Meter Necessary Fitting Remakinggood The Demolished Portion With Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Including Removing Existing Pipe Line If Necessary Andconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1013 Providing Andfixing 15Mm Diameterwatermeterwithnon-Returnvalve Includingstrainer, Sockets / Union Nut Including Water Meter Box Making Locking Arrangement And Lock. [ Withoutchamber ] . 1014 Providing Andfixing 20Mm Diameterwatermeterwithnon-Returnvalve Includingstrainer, Sockets / Union Nut Including Water Meter Box Making Locking Arrangement And Lock. ( Without Chamber ) . 1015 Providing Andfixing 25Mm Diameterwatermeterwithnon-Returnvalve Includingstrainer, Sockets / Union Nutandincludingwatermeterboxmakinglockingarrangementandlock. [ Without Chamber ] . 1016 Providing Andfixing 40Mm Diameterwatermeterwithnon-Returnvalve Includingstrainer, Sockets / Union Nut Andincludingwatermeterboxmakinglockingarrangementsandlock. [ Withoutchamber ] . 1017 Providing Andfixing 50Mm Diameterwatermeterwithnon-Returnvalve Includingstrainer, Sockets / Union Nutandincludingwatermeterboxmakinglockingarrangementandlock. [ Without Chamber ] 1018 Providing Andfixing 80Mm Diameterwatermeterwithnon-Returnvalve Includingstrainer, Sockets / Union Nutandincludingwatermeterboxmakinglockingarrangementandlock. [ Without Chamber ] . 1019 Providing And Fixing 100Mm Diameter Water Meter With Non-Return Valve Including Strainer, Sockets / Union Nutandincludingwatermeterboxmakinglockingarrangementsandlock. [ Without Chamber ] . 1020 Providingandfixing15mm Dia.Screwdownbib / Stoptapofbrassincluding Necessarysocketunionnut Complete. 1021 Providingandfixing20mm Dia.Screwdownbib / Stoptapofbrassincluding Necessarysocketunionnut Complete. 1022 Providingandfixing25mm Dia.Screwdownbib / Stoptapofbrassincluding Necessarysocketunionnut Complete. 1023 Providing And Fixing Screw Down 15 Mm Dia. Wheeled Stop Tap Of Brass Including Necessary Sockets / Union Nut Complete 1024 Providing And Fixing Screw Down For 20 Mm Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1025 Providing And Fixing Screw Down For 25 Mm Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1026 Providing And Fixing Screw Down For 32 Mm Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1027 Providing And Fixing Screw Down For 40 Mm Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1028 Providing And Fixing Screw Down For 50 Mm Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1029 Providing And Fixing Screw Down For 65 Mm Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1030 Providing And Fixing Screw Down For 80 Mm. Dia. Wheeled Stop Tap Of Brass Includingnecessary Sockets / Union Nut Complete. 1031 Providing And Fixing 100 Mm Dia. Chromium Plated Brass Showers Rose To 15Mm Dia. Supply Pipe Including Necessary Bend And Socket Complete. 1032 Providing And Fixing 15Mm Diameter Concussion Push Button Type Brass / Gun Metal Self-Closingtap Including Necessary Socket Complete. 1033 Providing And Fixing 25Mm Diameter Concussion Push Button Type Brass / Gun Metal Self-Closingtap Including Necessary Socket Complete 1034 Providing And Fixing Push Cock ( Self Closing Tap ) Symet Type Of 15 Mm Dia.Includingnecessary Socket, Testing Etc. Complete. 1035 Providing And Fixing Push Cock ( Self Closing Tap ) Symet Type Of 20 Mm Dia.Includingnecessary Socket, Testing Etc. Complete. 1036 Providing And Fixing 45 Cm Wide Mild Steel Ladder Of 40Mm X 6 Mm Mild Steel Flat Stringers Andstepsof18 Mm Dia. Mild Steel Bar For Water Tank Including Fixing It In ( 1:2:4 ) M-15Cement Concrete Block 60Cmx30cmx30cmandpaintingtheladdercomplete. ( Anticorossive Paint ) 1037 Providing Andfixing White Glazedearthenware Full Stall Type Urinal Withp.V.C. Flushing Cistern Of 5 Liters Capacity With Fitting, Inlet Pipes And Stop Tap, Brackets For Fixing The Cistern, 32 Mm Dia. P.V.C Flush Pipe With Fittings And Flushing Arrangement Including Lead Soil Pipe, Lead Trap, Soil Pipe Connectionup To The Outside Faceof The Wall 1038 Providing And Fixing White Glazed Earthenware Squatting Plate ( Ladies Urinal ) With P.V.C. Flushing Cistern Of 5Liters Capacity Withfitting, Inlet Pipes Andstoptap, Brackets For Fixing The Cistern, 32 Mm Dia. P.V.C Flush Pipe Withfittings Andflushing Arrangement Including Lead Soil Pipe, Lead Trap, Soil Pipe Connectionupto The Outside Face Of The Wall 1039 Providing And Fixing Coloured Glazed Earthenware Full Stall Type Urinal With P.V.C. Flushing Cistern Of 5 Liters Capacity With Fitting, Inlet Pipes And Stop Tap Brackets For Fixing The Cistern 32Mm Dia. P.V.C. Flush Pipe With Fittings And Flushing Arrangement Including Lead Soil Pipe, Lead Trap Soil Pipe Connection Up To The Outside Faceof The Wall 1040 Providing And Fixing White Glazed Earthenware Lipped Flat Back / Corner Type Urinal With Pvc 5 Liters Flushing Cistern With Fittings, Inlet Pipe With Stop Tap, Brackets For Fixing The Cistern, 32 Mm Diameter P.V.C. Flush Pipe With Fitting Including Lead Soil Pipe, Lead Trap And Soil Pipe Connection Up To The Outside Face Of Wall. 1041 Providing And Fixing Coloured Glazed Earthenware Lipped Flat Back / Corner Type Urinal Withpvc 5 Litersflushingcisternwithfittings, Capacitywithfittings, Inletpipeandstoptap, Brackets For Fixing The Cistern, P.V.C. Flush Pipe Withfittings Including Lead Soil Pipe, Lead Trap And Soil Pipe Connection Up To Theoutside Face Of The Wall. 1042 Providing And Laying 100 Mm Dia. Half Round White Glazed Earthenware Pipes In 1:5:10Cement Concrete Bedding Including Bends, Etc. Complete. 1043 Providingandfixingwhiteglazedearthenwarewashhandbasinof55cm.X40cm.Size Including Coldwaterpillartap / Coldandhotwaterpillartapbrackets, Rubberplugsandbrasschain, Stoptapand Necessary Pipe Connections Including P.V.C. Waste Pipe And Trap Up To The Outside Face Of The Wall. Makinggood The Damaged Surfacetesting Etccomplete 1044 Providingandfixingwhiteglazedearthenwarewashhandbasinof45cmx30cmsize Including Cold Water Pillar Tap / Cold And Hot Water Pillar Tap Brackets, Rubber Plugs And Brass Chain, Stop Tap And Necessary Pipe Connectionincluding P.V.C. Waste Pipe Andtrapuptothe Outside Face Ofthe Wall.Making Goodthedamaged Surfacetesting Etccomplete 1045 Providingandfixingwhiteglazedearthenwarewashhandbasinof63cmx45cmsize Including Bib Cockstoptapbrassheavy15mm, Brackets, Rubberplugsandbrasschain, Stoptapandnecessarypipe Connection Including P.V.C. Waste Pipe And Trap Up To The Outside Face Of The Wall. 1046 Providing Andfixing Colouredglazedearthenware Washhandbasinof 55Cm X40 Cm Size Including Cold Water Pillar Tap / Cold And Hot Water Pillar Tap Brackets, Rubber Plugs And Brass Chain, Stop Tap And Necessary Pipe Connectionincluding P.V.C. Waste Pipe Andtrapuptothe Outside Face Ofthe Wall.Making Goodthed Df T Ti T Lt 1047 Providing And Fixing Coloured Glazed Earthenware Wash Hand Basin Of 45 Cm X 30 Cm Size Including Cold Water Pillar Tap / Cold And Hot Water Pillar Tap Brackets, Rubber Plugs And Brass Chain, Stop Tap And Necessary Pipe Connectionincluding P.V.C. Waste Pipe Andtrapuptothe Outside Face Ofthe Wall.Making Goodthedamaged Surfacetesting Etc. Complete. 1048 Providingandfixing Whiteglazedwithbottletrapearthenwarewashhandbasinof55x40cm Size Includingcoldwaterpillertaps, Brackets, Rubberplugsandbrasschain, Stoptap, Chromium Plate Bottle Trap And Necessary Pipe Connections Including Upac Waste Pipe And Trap Upto The Outside Face Of The Wall, Making Good The Damaged Surfacetesting Etc. Complete. 1049 Providingandfixingwhiteglazedwithbottletrap Earthenwarewashhandbasinof 63X45 Cm Size Including Cold Water Piller Taps, Brackets, Rubber Plugs And Brass Chain, Stop Tap, Chromium Plate Bottle Trap And Necessary Pipe Connections Including Upac Waste Pipe Andtrapuptotheoutsidefaceofthewall, Makinggoodthedamagedsurface, Testingetc. Complete. 1050 Providingandfixing Colouredglazedwithbottletrap Earthenware Washhandbasinof 55X40 Cm. Size Including Cold Water Piller Taps, Brackets, Rubber Plugs And Brass Chain, Stop Tap, Chromium Plate Bottle Trap And Necessary Pipe Connections Including Upac Waste Pipe And Trapuptotheoutsidefaceof The Wall, Makinggoodthedamagedsurface, Testingetc. Complete. 1051 Providing And Fixing Coloured Glazed Earthenware Wash Hand Basin Of 63 Cm X 45 Cm Size Including Cold Water Pillar Tap / Cold And Hot Water Pillar Tap Brackets, Rubber Plugs And Brass Chain, Stop Tap And Necessary Pipe Connection Including P.V.C. Waste Pipe And Trap Up To The Outside Face Of The Wall. 1052 Providing And Fixing White Glazed Earthenware Sink 600Mm X 200Mm X 450Mm Including All Connection Of The G.I. Supply And P.V.C. Waste Pipes Up To The Outside Face Of The Wall, Cold Waterchromium Platedscrew Downbibtap, Rolledsteelorc.I.Brackets, Rubberplugwith Chain And Stop Tap Complete. 1053 Providing And Fixing White Glazed Earthenware Sink 450Mm X 200Mm X 300Mm Including All Connectionof The G.I. Supply Andlead Waste Pipes Up To The Outside Face Ofthe Wall, Cold Waterchromium Platedscrew Downbibtap, Rolledsteelorc.I.Brackets, Rubberplugwith Chain And Stop Tap Complete. 1054 Providing And Fixing Autoclosing Pillar Cock Of Pressmatic Tap Of Approved Make Orequivalent Including All Fixtures, Fittings Etc. Complete. 1055 Providing Andconstructing Granite Kitchenplatform Withfixing Of Stainlesssteelsink 600 Mm X 450Mm Sizeasperdetailed Drawingincludingverticalboth Sidepolished Kadappahstone25to30mmthick Supportswithkadappah Top35to40mm Thickandpolishedgranite 16To20mm Topwithside Stripsof Granite At Front And Both Sides Of Platform Raised With Two Verticalgranitesupports15cmheightandtop Graniteof75x40cmincludingcutting, Opening For Sink Of Required Size In Kadappah As Well As Granite Etc. Complete. ( Platform Top Size 5.00 M X 0.60 M And Height Is 0.75 M ) 1056 Providing And Fixing 8 Cm C.I. Nahani Trap Including C.I. Grating Bend And Piece Of C.I. Pipe Upto The Outside Face Of The Wall Complete. 1057 Providing Andfixing 10Cm C.I.Nahanitrapincludingc.I.Gratingbendandpiece Ofc.I. Pipe Upto The Outside Face Of The Wall Complete. 1058 Providing And Laying 100Mm Diameter Half Round Salt Glazed Stoneware Pipes In Brickmasonry Includingfittingssuchasbends, Tees, Singlejunction, Necessaryexcavationandjointing Complete. 1059 Providingandfixing15cmx10cmsaltglazedstonewaregullytrapincementconcrete1:4:8Outsidethebuilding Including Castirongrating Inthe Sink, Connecting Glazedstoneware Pipe, Brick Masonrychamber With Cast Iron Lid And Cast Iron Grating For The Gully Trap 1060 Providingandlaying100mm Diasaltglazedstoneware Pipeincluding Fittingssuchasbends, Tees, Single Junction, Double Junctions Laying, Jointing ( Including Excavation And Refilling Thetrenches ) Complete 1061 Providing Andlaying For 150 Mm Dia Salt Glazedstoneware Pipe Including Fittings Suchasbends, Tees, Single Junction, Double Junctions Laying, Jointing ( Including Excavation Andrefillingthe Trenches ) Complete. 1062 Providingandlayingfor225mmdia.Saltglazeds.W.Pipeincludingfittingsuchasbends, Tees, Single Junction, Double Junctions Laying, Jointing ( Including Excavation And Refilling The Trenches ) Complete 1063 Providingandlayingconcretepipesofi.S.Np.Classof100mmdiameterinproperline, Levelandslope Includingnecessarycollars, Excavation, Laying, Fixingwithcollarsincementmortar1:1Andrefillingthetrench Complete. 1064 Providingandlayingconcretepipesofi.S.Np.Classof150mmdiameterinproperline, Levelandslope Includingnecessarycollars, Excavation, Laying, Fixingwithcollarsincementmortar1:1Andrefillingthetrench Complete. 1065 Providingandlayingconcretepipesofi.S.Np.Classof225mmdiameterinproperline, Levelandslopeincludingnecessarycollars, Excavation, Laying, Fixingwithcollarsincementmortar1:1Andrefillingthe Trench Complete 1066 Providingandlayingconcretepipesofi.S.Np.Classof300mmdiameterinproperline, Levelandslopeincludingnecessarycollars, Excavation, Laying, Fixingwithcollarsincementmortar1:1Andrefillingthe Trench Complete 1067 Providingandconstructingbrickmasonryinspectionchamber60cmx45cmx90cm Including1:4:8 Cementconcretefoundation1:2:4Cementconcretechannelshalfroundg.S.W. Pipes, Brick Masonry, Plastering From Inside And Airtight C. I. Cover Of75kilogramwith Lid And Frame Fixed In Cement Concrete. 1068 Providingandconstructingbrickmasonryinspectionchamber90cmx45cmx90cm Including1:4:8 Cement Concrete Foundation 1:2:4 Cement Concrete Channels Half Roundg.S.W.Pipes, Brickmasonry, Plastering From Inside And C.I. Lid Cover Of 75Kilogramwith Lid And Frame Fixed In Cement Concrete. 1069 Providingandconstructingbrickmasonryinspectionchamber60cmx45cmx90cm Including1:4:8 Cementconcretefoundation1:2:4Cementconcretechannelshalfroundg.S.W. Pipes, Brick Masonry, Plastering From Inside And Withframe Fixedin Cement Concrete Withr.C.C.Cover Medium Duty 140Kilogramwith Frame Etc Complete 1070 Providingandconstructingbrickmasonryinspectionchamber90cmx45cmx90cm Including1:4:8 Cement Concrete Foundation 1:2:4 Cement Concrete Channels Half Roundg.S.W.Pipes, Brickmasonry, Plastering From Inside And With Frame Fixed In Cement Concrete With R.C.C. Cover Medium Duty140kilogramwith Frame Etc Complete 1071 Providing And Constructing Brick Masonry Inspection Chamber 90Cm X 45Cm Including 1:4:8C.Cfoundation, 1:2:4C.C.Channels / Halfroundglazedstonewarepipechannel, Saltglazed Stone-Ware Interceptingtrapwithroddingpipesetin1:4:8Cementconcreteblock, Brick Masonry Plastering Inside And Outside, With C.I. Lead Cover Of 75Kilogramwith Frame Fixed In Cement Concrete. 1072 Providingandconstructingbrickmasonryinspectiontrapchamber90cmx45cmincluding1:4:8 C.C Foundation, 1:2:4 C.C.Channels / Half Round Glazed Stoneware Pipe Channel, Saltglazed Stone-Ware Interceptingtrapwithroddingpipesetin1:4:8Cementconcreteblock, Brickmasonryplasteringinside Andoutside, Fixedincementconcretewithr.C.C.Cover Medium Duty 140 Kilogram. Etc Complete 1073 Providing Andconstructing Brick Masonry Inspection Chamber 60Cm X 45Cm With R.C.C. Raftinb.C.Soil Area Including Cost Of Reinforcement, 1:2:4 Cement Concretechannels Halfroundg.S.W.Pipes, Brick Masonry, Plasteringfrominsideandairtight75mmthickr.C.C.Covermediumduty100kilogrametc.Complete 1074 Providing Andconstructing Brick Masonry Inspection Chamber 90Cm X 45Cm With R.C.C. Raftinb.C.Soil Areaincludingcostofreinforcement, 1:2:4Cementconcretechannelshalf Roundg.S.W.Pipes, Brick Masonry, Plastering From Inside Andairtightwith75mm Thickr C C Didt 140Kilt Lt 1075 Providingandfixinghumepipeseptictank900mmdiameterwithventpipeandcapincludingnecessary ( Including Excavation And Laying ) 1076 Providingsoakpitofsize 120Cm X120cm X120cmincluding Excavatingandfilling With Brick-Bats. 1077 Providing Andfixing 450Mm X550mm Size Superiortype Belgium Mirrorwith16mmdia. Nickel Plated Towel Rod Etc. Complete. 1078 Providing, Layingand Fixingp.V.C. Pipeof 15Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1079 Providing, Layingand Fixingp.V.C. Pipeof 20Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1080 Providing, Layingand Fixingp.V.C. Pipeof 25Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1081 Providing, Layingand Fixingp.V.C. Pipeof 32Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1082 Providing, Layingand Fixingp.V.C. Pipeof 40Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1083 Providing, Layingand Fixingp.V.C. Pipeof 50Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1084 Providing, Layingand Fixingp.V.C. Pipeof 75Mmdia. With Fittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipe Lineifnecessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1085 Providing, Laying Andfixing P.V.C. Pipe Of 110Mm. Dia. Withfittings Such As Bends, Tees, Reducers, Clamps, Etc. Including Necessary Excavation, Trench Filling Etc. Complete. Including Removingexistingpipelineif Necessaryandconveyingandstackingthesameinpwd Chowky Or As Directed Etc. Complete. 1086 Providing Andfixing Partitionwithkadappastone Ofall Sizesand25mm Thickpolishedonbothside And Edges To Original Including Fixing In Position In Cement Mortor 1:4 Curing Polish-Ingcleaning Etc Complete 1087 Providingandfixingorissatypewhiteglazedearthenware575mmwaterclosetpan Including S Trap Withearthenware Footrests, Castironsoilandventpipe Uptooutside Face Ofthe Wall 1:2:4Brick Batlimeconcrete Bedding Without Flushing Tank And Its Accessories Etccomplete 1088 Providing And Fixing Chromium Platedtowel Rod16 Mm Dia And75 Cm. In Lengthincluding All Accessories Complete. 1089 Providing And Fixing Half Turn 25 Mm Dia Gun Metal Flushing Cock Including All Accessories Etc. Complete. 1090 Providing And Fixing 1St Class White Glazed Earthenware Orissa Type W.C. Pan 580 Mm Dia Including P Or S Trap Cast Iron Soil And Vent Pipe Upto The Outside Face Of The Wall ( 1:5:1 0 ) Cement Concrete Bedding 15 Mm Thick, 10 Liter P.V.C. Flushing Cistern With All Necessary Pipe Connection Etc. Complete. 1091 Providing And Fixing European Type White Glazed Earthenware Coupled Closet Symphonic Trap Withsymphonic Lowlevelwhiteglazed10litrescisternwithblackbackliteseatwithall Necessary Pipe Connection Etc.Complete. 1092 Providing And Fixing Orissa Type Colour Glazed Earthenware 625 X 450 Mm. W.C. Pan Including Trap, C.I. Soil And Vent Pipe Upto The Out Side Face Of Wall Including 100 Mm. Dia. C.I. Plug, Bend, 15Mm.Thick10litre Pvcflushingcisternwithallnecessarypipeconnectionetc. Complete. 1093 Providing And Fixing 40Mm. Diaball Cockmedium Type Withpvcfloat Including Sockets Andnecessary Fittings And Tested As Per Municipal Requirements Etc. Complete. 1094 Providing And Fixing 15Mm. Diaball Cockmedium Type Withpvcfloat Including Sockets Andnecessary Fittings And Tested As Per Municipal Requirement Etc. Complete. 1095 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete.I ) Tank Capacity Up To 2, 000Litre. 1096 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete.Ii ) Tank Capacity Up To2 001 To 5000 Litre. 1097 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete. Iii ) Tank Capacity Up To5 001 To 7000 Litre 1098 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete. Iv ) Tank Capacity Up To 7, 001 To10000 Litre 1099 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylonbrush, Coir String Andduster, Bailing Out Water Etc. Complete. V ) Tank Capacity Upto10 001 To 15 000 Litre 1100 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete. Vi ) Tank Capacity Upto15 001 To 20 000 Litre. 1101 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete.Vii ) Tank Capacity Upto20 001 To 30 000 Litre. 1102 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete.Viii ) Tank Capacity Upto30 001 To 40 000 Litre 1103 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete.Ix ) Tank Capacity Up To40 001 To 50000 Litre 1104 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete. X ) Capacity 50, 001 Litreto One Lakh 1105 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylon Brush, Coir String And Duster, Bailing Out Water Etc. Complete. Xi ) Capacity Above Onelakh Uto 4.00 Lakh 1106 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylonbrush, Coirstring Andduster, Bailingoutwateretc.Complete.Xii ) Capacityabove4.00 Lakh Upto 7.00 Lakh . 1107 Cleaning Elevated Water Storage Reservoir Within A Given Period, By Using Bleaching Powder At The Rate Of 14 Gm / Sq.M .Washing Thrice Potassium Permanganate At The Rate Of 2.50Gm / Sq.M. Finally, Cleaning Washing By Using Nylonbrush, Coir String Andduster, Bailing Out Water Etc. Complete.Xiii ) Capacityabove7.00 Lakh Upto 12.00 Lakh. 1108 Providing And Fixing 75 Mm Dia Stabiliser Pipe / P.V.C. Soil Vent / Waste Pipe And Withnecessary Fixtures Andfitting Such As Bends, Tees, Single Junctions, Slotted Vent, Clamps Etc.Complete 1109 Providing And Fixing 100 Mm Dia Stabiliser Pipe / P.V.C. Soil Vent / Waste Pipe And Withnecessary Fixtures Andfitting Such As Bends, Tees, Single Junctions, Slotted Vent, Clamps Etc.Complete. 1110 Providing And Fixing H.D.P Container One Piece Moulded Water Tank Made Out Of High Density Polythyler And Builtcorrugatedinclusiveofdeliveryuptodestinationhoistingand Fixing Of Accessories Such As Inlet, Outletoverflowpipeinclusiveofalltankscapacity Between 200 To 1000 Liters 1111 Providing And Fixing H.D.P Container One Piece Moulded Water Tank Made Out Oflowdensitypolythylerandbuiltcorrugationincludingofdeliveryuptodestination Hoisting Andfixing Of Accessories Such As Inlet, Outlet Overflow Of Alltanks Capacityabove 1000 To 20 000 Litres 1112 Providing And Fixing On Walls / Ceiling / Floor 15 Mm Dia. Cpvc Pipe With Necessary Fittings, Remaking Good The Demolished Portion Etc. Complete. Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1113 Providing Andfixing Onwalls / Ceiling / Floor 20Mm Dia.Cpvc Pipe Withnecessary Fittings, Remaking Good The Demolished Portion Etc. Complete. Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1114 Providing And Fixing On Walls / Ceiling / Floor 25 Mm Dia. Cpvc Pipe With Necessary Fittings, Remaking Good The Demolished Portion Etc. Complete. Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1115 Providing And Fixing On Walls / Ceiling / Floor 32 Mm Dia. Cpvc Pipe With Necessary Fittings, Remaking Good The Demolished Portion Etc. Complete. Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1116 Providing And Fixing On Walls / Ceiling / Floor 40 Mm Dia. Cpvc Pipe With Necessary Fittings, Remaking Good The Demolished Portion Etc. Complete. Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1117 Providing And Fixing On Walls / Ceiling / Floor 50 Mm Dia. Cpvc Pipe With Necessary Fittings, Remaking Good The Demolished Portion Etc. Complete. 1118 Providing And Laying In Trenches 15 Mm Dai. Cpvc Pipe Including Necessary Excavation, Fittings. Refilling Trenches Etc. Completeincludingremovingexistingpipe Lineif Necessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1119 Providing And Laying In Trenches 20 Mm Dai. Cpvc Pipe Including Necessary Excavation, Fittings. Refillingtrenchesetc.Complete.Includingremovingexistingpipelineif Necessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1120 Providing And Laying In Trenches 25 Mm Dai. Cpvc Pipe Including Necessary Excavation, Fittings. Refillingtrenchesetc.Complete.Includingremovingexistingpipelineif Necessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1121 Providing And Laying In Trenches 32 Mm Dai. Cpvc Pipe Including Necessary Excavation, Fittings. Refillingtrenchesetc.Complete.Includingremovingexistingpipelineif Necessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1122 Providing And Laying In Trenches 40Mm Dai. Cpvc Pipe Including Necessary Excavation, Fittings. Refillingtrenchesetc.Complete.Includingremovingexistingpipelineif Necessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1123 Providing And Laying In Trenches 50Mm Dai. Cpvc Pipe Including Necessary Excavation, Fittings. Refillingtrenchesetc.Complete.Includingremovingexistingpipelineif Necessaryandconveyingand Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1124 Providing And Fixing 10 Cm Pvc Nahani Trap With Grating Etc. Complete. 1125 Providingandfixingreinforcedcementconcrete Coverofsize90cmx45cm Withframe Overinspection Chamber Etc. Complete. Heavy Duty ( 225 Kilogram ) 1126 Providingandfixingreinforcedcementconcrete Coverofsize90cmx45cm Withframe Overinspection Chamber Etc. Complete. Medium Duty ( 140 Kilogram ) 1127 Providingandfixingreinforcedcementconcrete Coverofsize60cmx45cm Withframe Overinspection Chamber Etc. Complete. Heavy Duty ( 160 Kilogram ) 1128 Providingandfixingreinforcedcementconcrete Coverofsize60cmx45cm Withframe Overinspection Chamber Etc. Complete.Medium Duty ( 100 Kilogram ) 1129 Providing Andmaking Isi Mark Ferrule Connectionof15mm Dia. To Water Mainincluding Ferrulecoupling Castironbellmouthcover, Builtinnonreturnvalveandfixingincluding Excavation And Reinstatementcomplete. 1130 Providing Andmaking Isi Mark Ferrule Connectionof20mm Dia. To Water Mainincluding Ferrulecouplingcastironbellmouthcover, Builtinnonreturnvalveandfixingincluding Excavation And Reinstatement Complete. 1131 Providing And Making Isi Mark Ferrule Connection Of 25Mm Dia.To Water Main Includingferrule Coupling Cast Iron Bell Mouth Cover, Built In Non Return Valve And Fixingincluding Excavationandreinstatement Complete. 1132 Providing Andmaking Isi Mark Ferrule Connectionof32mm Dia. To Water Mainincluding Ferrulecoupling Castironbellmouthcover, Builtinnonreturnvalveandfixingincluding Excavation And Reinstatementcomplete. 1133 Providing And Making Isi Mark Ferrule Connection Of 40Mm Dia. To Water Main Includingferrule Coupling Cast Iron Bell Mouth Cover, Built In Non Return Valve And Fixingincluding Excavationandreinstatement Complete 1134 Providing Andmaking Isi Mark Ferrule Connectionof50mm Dia. To Water Mainincluding Ferrulecoupling Castironbellmouthcover, Builtinnonreturnvalveandfixingincluding Excavation And Reinstatementcomplete 1135 Providingandfixingstainlesssteelsinkofsize600x510x200mm Incluidngcoupling, Outlet Pipe, Elbow And Other Necessary Fitting, Finishing Etc. Complete. 1136 Providingandfixingc.P.Angularstopclockwithwallflangeofapprovedmakecontinentalincluding Necessary Sockets / Union Nut Etc. Complete. 1137 Providing And Fixing C.P.Two Way Bib Cock Of Approved Make Continentalincludingnecessary Sockets / Union Nut Etc. Complete. 1138 Providing And Fixing C.P. Wall Mixer With Provision For Overhead Shower With 115Mm Long Bendpipeand Wallflangeofapprovedmakeincludingnecessarysockets / Unionnutetc.Complete. 1139 Providing And Fixingc.P. Pillar Cock Longneck With Aerator Of Approed Makeincludingnecessary Sockets / Union Nut Etc. Complete. 1140 Providing And Fixing C.P. Bib Cock With Wall Flange Of Approved Make Including Necessary Sockets / Union Nut Etc. Complete. 1141 Providing And Fixing C.P. Sink Cock With Raised J Shaped Swinging Casted Spout Ofapproved Make Including Necessary Sockets / Union Nut Etc. Complete. 1142 Providingandfixingp.V.C.Rainwaterpipesof160mmouterdiameterandhavingwall Thicknessof2.2To2.7Mmconfirmingtoi.S.13592-1992Includingproperrainwater Receiving Recess With P.V.C. Plug, Bend, Necessary Fittings, Such As, Offsets, Shoes, Inluding Fixing The Pipe On Wall Using Approved Wooden Cleats Projecting 25Mm To 40Mm From Face Of Wall A Fixing With Clips Of Approved Quality And Number , Filing The Joint Using Rubber Gasket Withsolventcementandproperlyrestingtheshoeofpipesonc.C.Or Masonryblocks, Including Necessary Scaffolding And Maintenance For 3 Yrs For Any Leakages Or Dislocations Of Pipes. All The P.V.C. Fittings Andadditional 2Piece Socket Clips Shall Be Got Approvedfrom Engineer In Charge Etc. Complete. 1143 Providingandfixingeuropeantypewall-Hungwhitewaterclosetofapprovedmakewith Push Valve Concealed Type With Cover Plate 32Mm Size Of Approved Make Including Soil Pipe, Ventpipeuptooutside Faceofwall, 100Mmdia.G.I.Plugbendinletpipeallfittings, Cuttingand Making Good Walls, Floors Etc.Complete 1144 Providingandfixingp.V.C.Rainwaterpipesof110mmouterdiameterandhavingwall Thicknessof2.2To2.7Mmconfirmingtoi.S.13592-1992Includingproperrainwater Receiving Recess With P.V.C. Plug, Bend, Necessary Fittings, Such As, Offsets, Shoes, Inluding Fixing The Pipe On Wall Using Approved Wooden Cleats Projecting 25Mm To 40Mm From Face Of Wall A Fixing With Clips Of Approved Quality And Number , Filing The Joint Using Rubber Gasket Withsolventcementandproperlyrestingtheshoeofpipesonc.C.Or Masonryblocks, Including Necessary Scaffolding And Maintenance For 3 Yrs For Any Leakages Or Dislocations Of Pipes. All The P.V.C. Fittings Andadditional 2Piece Socket Clips Shall Be Got Approvedfrom Engineer In Charge Etc. Complete. 1145 Providing And Fixing Oval Type Under Counter Wash Hand Basin Of 16 Inch X 22 Inch Size And Ofspecialcolour Shadehavingtelephonicblack / Colouredgraniteof180mm Thickstone Blackkadappaframework Includingchromiumplatedcouplingbottle-Trapusingcera Companyorequivalentovaltypawash Basinmodelno 3448Asperdetaileddrawing Oras Directed By Engg Incharge Etc Complete. ( Counter Size1 20 M X 0 60 M ) 1146 Providingandlayinginwalls / Ceilings / Floors15mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 1.25Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint, 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdi Td T Lt 1147 Providingandlayinginwalls / Ceilings / Floors20mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 1.63Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint, 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdirected Etc. Comlete. 1148 Providingandlayinginwalls / Ceilings / Floors25mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 2.49Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdirected Tcomplte 1149 Providingandlayinginwalls / Ceilings / Floors32mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 3.20Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdi Td T Lt 1150 Providingandlayinginwalls / Ceilings / Floors40mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 3.68Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdi Td T Lt 1151 Providingandlayinginwalls / Ceilings / Floors50mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 5.17Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdirected Tcomplte 1152 Providingandlayinginwalls / Ceilings / Floors80mmdia.Mediumgradehavingembossedasisimark Galvanisedironpipes Of 8.57Kilogram / Metre Necessary Fitting Remaking Goodthe Demolishedportionwith Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdirected Etccomplete 1153 Providingandlayinginwalls / Ceilings / Floors100mmdia.Mediumgradehavingembossedasisimark Galvanised Iron Pipes Of 12.43 Kilogram / Metre Necessary Fitting Remaking Good The Demolished Portion With Filling Trenches And With Primer Of Anti-Corrosive Oil Paint , 2 Coats Complete. Including Necessary Scaffolding And Removing Existing Pipe Line If Necessaryand Conveying And Stacking The Same In Pwdchowky Or Asdi Td T Lt 1154 Providing And Layingin Trenches 15 Mmdia.Heavy Gradehaving Embossed As Isimarkgalvanised Ironpipesof1.48Kilogram / Metrenecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimer Ofanti-Corrosive Oilpaint , 2 Coatscomplete. Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1155 Providingandlayingintrenches20mmdia.Heavygradehavingembossedasisimark Galvanised Ironpipesof1.93Kilogram / Metrenecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimer Ofanti-Corrosive Oilpaint , 2 Coatscomplete. Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1156 Providingandlayingintrenches25mmdia.Heavygradehavingembossedasisimark Galvanised Ironpipesof3.01Kilogram / Metrenecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimer Ofanti-Corrosive Oilpaint , 2 Coatscomplete. Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1157 Providingandlayingintrenches32mmdia.Heavygradehavingembossedasisimark Galvanised Ironpipesof3.89Kilogram / Metrenecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimer Ofanti-Corrosive Oilpaint , 2 Coatscomplete. Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1158 Providingandlayingintrenches40mmdia.Heavygradehavingembossedasisimark Galvanised Ironpipesof4.49Kilogram / Metrenecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimer Ofanti-Corrosive Oilpaint , 2 Coatscomplete. Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1159 Providingandlayingintrenches50mmdia.Heavygradehavingembossedasisimark Galvanised Ironpipesof6.33Kilogram / Metrenecessaryfittingremakinggoodthedemolishedportion With Filling Trenchesandwithprimer Ofanti-Corrosive Oilpaint , 2 Coatscomplete. Including Removing Existing Pipe Line If Necessaryandconveying Andstacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1160 Providingandlayingintrenches80mmdia.Heavygradehavingembossedasisimark Galvanised Iron Pipes Of 10.15 Kilogram / Metre Necessary Fitting Remaking Good The Demolished Portion With Filling Trenchesandwithprimerofanti-Corrosive Oilpaint, 2Coatscomplete.Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1161 Providingandlayingintrenches100mmdia.Heavygradehavingembossedasisimark Galvanised Iron Pipes Of 14.74 Kilogram / Metre Necessary Fitting Remaking Good The Demolished Portion With Filling Trenchesandwithprimerofanti-Corrosive Oilpaint, 2Coatscomplete.Including Removing Existing Pipe Line If Necessary And Conveying And Stacking The Same In Pwd Chowky Or As Directed Etc. Complete. 1162 Providing And Fixing 8 Cm Rigid Pvc Nahani Trap Including Pvc Grating , Bend, Connecting Piece Of Upvc Pipeuptotheoutsidefaceof Wall, Makingthegood Damaged Surfaceandtestingetc.Complete ( Prior Approval Of Sample And Brand By Ex. Engr. Is Necessary Beforeuse ) 1163 Providingandfixing15cmrigidpvcnahanitrapincludingpvcgrating, Bend, Connectingpieceofupvcpipeuptotheoutsidefaceofwall, Makingthegood Damaged Surface And Testing Etc. Complete ( Prior Approval Of Sample And Brand By Ex. Engr. Is Necessary Before Use ) 1164 Providing And Fixing European Type White Glazed Earthenware Water Closet Pan With Upvc Seat And Lid With Chromium Plated Brass Hinges And Rubber Buffers Including Upvc And Vent Pipe Up To The Outside Face Of Wall 10 Litre Enameled Low Level Flushing Cistern With Fittings Pipe Stop Tap Brackets For Fixing Cistern 32 Mm Dia. Upvc Flush Pipe With Fittings And Clamps, 20 Mm Dia.Upvc Overflow Pipe , Mosquito Proof Couplings G.I. Chain And Pulley, With Water Jetandfitting Including Cutting And Making Good To The Walls And Floors Testing Etc.Complete. ( Priorapprovalofl D B D B Eeiibf ) 1165 Providing And Fixing European Type White Glazed Earthenware Water Closet Pan With Upvc Seat And Lid With Chromium Plated Brass Hinges And Rubber Buffers Including Upvc And Vent Pipe Up To The Outside Face Of Wall Withoutflushingcisternwithflushcockandwithwaterjetandnecessaryfittingsincludingcuttingand Makinggoodtothewallsandfloorstestingetc.Complete. ( Priorapprovalofsampleandbrandbyex.Eiibf ) 1166 Providing And Fixing European Type Colour Glazed Earthenware Water Closet Pan With Upvc Seat And Lid With Chromium Plated Brass Hinges And Rubber Buffers Including Upvc And Vent Pipe Up To The Outside Face Of Wall 10 Liter Enameled Low Level Flushing Cistern With Fittings Pipe Stop Tap Brackets For Fixing Cistern 32 Mm Dia. Upvc Flush Pipe With Fittings And Clamps, 20 Mm Dia.Upvc Overflow Pipe , Mosquito Proof Couplings G.I. Chain And Pulley, With Water Jetandfitting Including Cutting And Making Good To The Walls And Floors Testing Etc.Complete. ( Priorapprovalofl D B D B Eeiibf ) 1167 Providing And Fixing European Type Colour Glazed Earthenware Water Closet Pan With Upvc Seat And Lid With Chromium Plated Brass Hinges And Rubber Buffers Including Upvc And Vent Pipe Up To The Outside Face Of Wall Withoutflushingcisternwithflushcockandwithwaterjetandnecessaryfittingsincludingcuttingand Makinggoodtothewallsandfloorstestingetc.Complete. ( Priorapprovalofsampleandbrandbyex.Engineer I Necessary Before Use ) 1168 Providing And Fixing Anglo Indian Type White Glazed Earthenware Water Closet Pan With Trap Withupvcseat Andlidwithchromiumplatedbrasshingesandrubberbuffersincluding Upvc And Vent Pipe Up To The Outside Face Of Wall With Flushing Cistern And Necessary Fittings Includingcuttingandmakinggoodtothe Wallsandfloorstestingetc.Complete. ( Prior Approval Of Sample And Brand By Ex. Engineer Is Necessarybf ) 1169 Providing Andfixing Highlevel 10 Liter Capacity Withfittings Inlet Pvc Pipe Withstoptap, Brackets For Fixing The Cistern, 32 Mm Dia. Pvc Flush Pipe With Fitting And Clamps 20 Mm Dia. Pvc Overflow Pipe With Mosquito Proof Couplings, Galvanised Iron Chain And Pulley Painting If Ordered To Cistern Pipe Etc. And Cutting And Making Good The Damaged Wall And Testing Etc. Complete ( Prior Approval Of Sample And Brandby Ex. Engr. Is Necessary Before Use ) 1170 Providing Andfixing In Positionupvc Ultra Violet Stabilized110 Mm Outer Diameter Cowl Dome Confirming To I.S.-4985 Including Making Joints With Solvent Cement Etc. Complete 1171 Providing Andfixing Glassself 125Mm Wide And600mm Long Withnecessary Chromium Plated Brackets Providing T.W.Gutties Etc. Complete 1172 Providing, Constructingandfixing 250Mmdia.Inspectionchambermadeupofupvc Material Of Thickness 3.5 Mm And Height Of 259 Mm With Inlet And Outlet Of 110 Mm Dia. With 75 Mm Dia. U Trap, Ultra Shaft Pipe Of Upvc Material Having Height Of 470 Mm And Fixing Ultra 250 Mm Dia. Upvc Cover And Frame In 150 Mm Thick In C.C.1:2:4, Having Crushed Sand Bedof100mmthickofsize550mmdia.Including Excavation And Refilling The Sides Ofchamber By Crushed Sand Cushioning 150 Mm Thickness, Connectingallrequiredupvc Fittings With Rubber Lubricant Etc. Complete. 1173 Providing , Constructing And Fixing 450 Mm Dia. Inspection Chamber Made Up Of Polypropylene / Polyethylene Material Of Thickness 3.5 Mm And Height Of 388 Mm With 160 Or 200 Mm Main Inlet ( S ) Outlet And 110 And / Or 160 Mm Branch Inlets, With 450 Mm Dia. Ultra Shaft Pipe Of Hdpe Material Having Height Of 460 Mm, Having R.C.C. Cover And Frame Fixing In 150 Mm Thick In C.C.1:2:4, Having Crushed Sand Bed Of 150 Mmthickofsize750mmdia.Includingexcavationandrefillingthesidesofchamberbysandcrushed Cushioning 150 Mm Thickness, Connecting All Required Upvc Fittings With Rubber Lubricant Etc. Complete. 1174 Providing , Constructing And Fixing600 Mm Dia. Inspection Chamber Made Up Of Polypropylene / Polyethylene Material Having 315 Mm Diameter Inlet ( S ) / Outlets And Witheccentric Reducers As Per Requirement To Connect 160 Mm And 200 Mm Pipes Having Thickness Of5mmand600mm Inheight, Withinbuiltshaftachievetheinvertdepthaspersite Condition Of Wall Thickness Of 5Mm Having R.C.C. Cover And Frame Fixing In 150 Mm Thick In C.C.1:2:4, Having Crushed Sand Bed Of 150 Mm Thick Of Size 750 Mm Dia. Including Excavation And Refilling The Sides Of Chamber By ?Sand Crushed Cushioning 150 Mm Thickness, Connecting All Required Upvc Fittings With Rubber Lubricant Etc.Complete. 1175 Providing , Laying And Fixing , Jointingeco- Drain 110 Mm Sn 8 Nu- Drain Upvc Pipes Or Of Equivalent Make, Manufacture As Per En13476or Equivalent As Per I.S.15328Withfittings Sucha Bends, Tees, Coupler, Etc, Jointingwithrubberlubricantincludingnecessaryexcavation, Trenchrefillingwithselectiveexcavatedmaterial Etc. Complete. 1176 Providing , Laying And Fixing , Jointingeco- Drain 160 Mm Sn 4 Nu- Drain Upvc Pipes Or Of Equivalent Make, Manufacture As Per En 13476 Or Equivalent As Per I.S.15328 With Fittings Such Abends, Tees, Coupler, Etc, Jointingwithrubber Lubricant Includingnecessary Excavation, Trenchrefilling Withselective Excavatedmaterialetccomplete 1177 Providing , Laying And Fixing , Jointingeco- Drain 200 Mm Sn 4 Nu- Drain Upvc Pipes Or Of Equivalent Make, Manufacture As Per En 13476 Or Equivalent As Per I.S.15328 With Fittings Suchabends, Teestees, Coupler Etc, Jointingwithrubberlubricantincludingnecessary Excavation, Trench Refilling With Selective Excavatedmaterialetccomplete 1178 Providing , Laying And Fixing, Jointing Eco Drain 250 Mm Sn-04 Nu-Drain Upvc Pipe Or Of Equivalent Make, Manufactureasperen13476orequivalentasperi.S.15328 &16098Withfittingssuchabends, Tees, Coupler, Etc.Jointingwithrubberlubricant, Includingnecessaryexcavation, Trenchrefillingwithselectivetdt Il T Lt 1179 Providing , Laying And Fixing, Jointing Eco Drain 315 Mm Sn-04 Nu-Drain Upvc Pipe Or Of Equivalent Make, Manufactureasperen13476orequivalentasperi.S.15328 &16098Withfittingssuchabends, Tees, Coupler, Etc.Jointingwithrubberlubricant, Includingnecessaryexcavation, Trenchrefillingwithselectiveexcavated Material Etc. Complete. 1180 Providingandfixing15mmdiameterpvcaquakrafttypeofapprovedmakesuperbibtapwithflange Including All Accessories Etc Complete 1181 Providing Andfixing 15Mm Diameterpvcaquakrafttypeofapprovedmake Supertwo Way Bib Tap With Flange And Extender Including All Accessories Etc Complete 1182 Providing Andfixing 15Mm Diameterpvcaquakrafttype Ofapprovedmake Superpush Button Type Cock / Tap With Flange Including All Accessories Etc Complete 1183 Providing And Fixing 15 Mm Diameter Pvc Aqua Kraft Type Of Approved Make Super Wall Sink Type Tap With Flange Including All Accessories Etc Complete 1184 Providing And Fixing 15 Mm Diameter Pvc Aqua Kraft Type Of Approved Make Super Jet Spray With Flange 2 In 1 Faucet 1.50 Metre Long Including All Accessories Etc Complete 1185 Providing Andfixing 15Mm Diameterpvcaquakrafttypeofapprovedmake Superright Angle Stop Tap With Flange Including All Accessories Etc Complete 1186 Providing Andfixing 15Mm Diameter Pvcaqua Kraft Type Of Approved Make Super Pillar Tap Withflange Including All Accessories Etc Complete 1187 Providing And Fixing Isi 1729 / 2002 Grade 75 Mm Dia Cast Iron Waste Water Pipe With Lugs Necessary Fittings Such As Bends, Tees, Single Junction, Double Junction, Slotted Vent, Offsets On Wall Or Into The Ground Including Filling Joints With Cement Mortar 1:2 Proportion Fixing On Wall By Means By Galvanised Mild Steel Bracket Of 30 X 5 Mm Plate And 8 Mm Square Rod With Galvanised Iron Clamp With Washer As Per Design Drawing And As Directed To Keep Pipe 50 Mm Away From Wall Including Necessary Scaffolding And Painting The Exposed Faces Withone Coat Of Redleadoil Paint Andtwo Coats Of Gray Oil Paint Including Removing The Existing Pipe If Necessary And Conveying And Stacking In Pwd Chowky Or As Directed By Engineer-In-Charge. 1188 Providingandfixingisi1729 / 2002Grade100mmdiacastironsoilpipeswithlugs Including Plug Bend Necessary Fittings Such As Bends, Tees, Single Junction, Double Junction, Slotted Vent, Offsets On Wall Or Intothegroundincludingfillingjointswithcementmortar1:2Proportionfixingonwallbymeansof Galvanised Mild Steel Bracket Of 30 X 5 Mm Plate And 8 Mmsquarerodwithgalvanisedironclampwith Washerasperdesign, Drawingandas Directed To Keep Pipe 50 Mm Away From Wall Including Necessary Scaffolding And Painting The Exposed Faces With One Coat Of Red Lead Oil Paint And Two Coats Of Whiteoil Paint Including Removing The Existing Pipe If Necessary And Conveying And Stacking In Pwd Chowky Or As Directedby Engineer-In-Charge. 1189 Providing And Fixing Wall Mounted European Type White Glazed Earthenware Water Closet Pan Withupvc Seatandlidwithchromiumplatedbrasshingesandrubberbuffersincluding Upvc And Vent Pipe Up To The Outside Face Of Wall 10 Liter Enameled Low Level Flushing Cistern Withfittingspipestoptapbracketsfor Fixingcistern32mmdia.Upvcflushpipewith Fittingsandclamps, 20Mm Dia.Upvcoverflowpipe, Mosquito Proofcouplings G.I.Chain Andpulley, Withwaterjetandfittingincludingcuttingandmaking Goodtothewallsand Floors Testing Etc. Complete. ( Prior Approval Of Sample And Brand By Ex. Engineer Is Necessary Before Use ) 1190 Guniting By Drymix Process As Per Is 9012 ( 1978 ) To Ceiling Sofit Etc. In C.M. 1:3, 20Mm Thickunder Pressureof2.1Kilogramto2.8Kilogrampersq.Cmincludingforms, Scaffolding, Floating The Surface, Curing For 14 Days Etc. Complete ( Excluding Reinforcement ) 1191 Guniting By Drymix Process As Per Is 9012 ( 1978 ) To Ceiling Sofit Etc. In C.M. 1:3, 25Mm Thickunderpressureof2.1Kilogramto2.8Kilogrampersq.Cmincludingforms, Scaffolding, Floating The Surface, Curing For 14 Days Etccomplete ( Excluding Reinforcement ) 1192 Guniting By Drymix Process As Per Is 9012 ( 1978 ) To Ceiling Sofit Etc. In C.M. 1:3, 40Mm Thick Under Pressureof2.1Kilogramto2.8Kilogrampersq.Mincludingforms, Scaffolding, Floating The Surface, Curing For 14 Days Etccomplete ( Excluding Reinforcement ) 1193 Guniting By Drymix Process As Per Is 9012 ( 1978 ) To Ceiling Sofit Etc. In C.M. 1:3, 50Mm Thick Under Pressureof2.1Kilogramto2.8Kilogrampersq.Cmincludingforms, Scaffolding, Floating The Surface, Curing For 14 Days Etc. Complete ( Excluding Reinforcement ) 1194 Guniting By Drymix Process As Per Is 9012 ( 1978 ) Tobeams In C.M. 1:3, 20Mm Thick Under Pressureof 2.1Kilogramto2.8Kilogrampersq.Cmincludingforms, Scaffolding, Floatingthe Surface, Curing For 14 Daysetc. Complete ( Excluding Reinforcement ) 1195 Guniting By Drymix Process As Per Is 9012 ( 1978 ) Tobeams In C.M. 1:3, 25Mm Thick Under Pressureof 2.1Kilogramto2.8Kilogrampersq.Cmincludingforms, Scaffolding, Floatingthe Surface, Curing For 14 Daysetc. Complete ( Excluding Reinforcement ) 1196 Gunitingbydry Mixprocessasperis9012 ( 1978 ) Tothe Verticalsurface ( Otherthan Column ) In C.M. 1:3, 20Mm Thick Under Pressure Of 2.1Kilogramto 2.8Kilogramper Sq.Cm.Including Forms, Scaffolding, Floatingthesurfacecuringfor14daysetc.Complete ( Excluding Reinforcement ) 1197 Gunitingbydry Mixprocessasperis9012 ( 1978 ) Tothe Verticalsurface ( Otherthan Column ) In C.M. 1:3, 25Mm Thick Under Pressure Of 2.1Kilogramto2.8Kilogrampersq.Cm.Including Forms, Scaffolding, Floatingthesurfacecuringfor14daysetc.Complete ( Excluding Reinforcement ) 1198 Providing And Erecting 1.5 Metre High Wire Fencing With Seven Rows Of Barbed Wire Supported On M.S.Angles ( 50Mm X 50Mm X 6Mm ) At 2.5 Metres, Center To Center Including Excavating Pits For Foundqtion, Fixing Post In Cement Cocnrete 1:4:8 Of Size 45 X 45 X 45 Cm Fastening The Wire And Painting The M.S.Angles With One Coat Of Red Lead Primer And Two Coats Of Painting Etc.Complete. 1199 Providing Andfixing Mildsteelgrillgate Withangle Ironframe 65Mm X65mm X10mm Withironbarsat 150Mm C / C And Diagonal Flats As Per The Detailed Drawing Including Hinges, Pivot Block Locking Arrangement, Welding Riveting And Oil Painting Of Three Coats Of Approved Shade Weight Of Gate 35 Kilogram / Smt. 1200 Providingandfixing90cmx60cmmarbleplateengraving10cm.Heightletter, Figures Including Painting The Lefters / Figures With Approved Colour And Shade Complete 1201 Providingandfixing90cmx60cm Graniteplateengraving10cm.Heightletter, Figures Including Painting The Lefters / Figures With Approved Colour And Shade Complete 1202 Providing And Erecting 1.2 Meter High Wire Fencing With Five Rows Of Barbed Wire Supported Onmildsteel Angle ( 50X50x6mm ) Postat2.5Mc / Cincludingexcavationofpitsof Foundation Concrete Fixing The Posts In ( 1:4:8 ) Cement Concrete Block Of 45X45x45 Cm And Fastening The Wires And Painting The Angles With One Coat With Red Lead Primer And Two Coats Of Oil Painting Etc.Complete 1203 Providing Andfixing Rain Tattis Withbamboos Andkarve Grass With 75 Mm Thick Grass And Removing The Same After Rain Is Over ( Size Of Bamboos 50 Mm To 75Mm Dia And 3 M To 3.5 Mlong ) 1204 Providingandfixinggrasschhapper ( Roof ) Withnecessarybamboosandkarveframewith 75Mm. Thick Grass Etc.Removing The Same After Rain Is Over ( Size Of Bamboos 50Mm To 75Mm Dia And 3 M To 3.5M Long ) 1205 Providingandfixinggrasschhapper ( Roof ) Withnecessarybamboosandkarveframewith 75Mm. Thick Grass Etc.Removing The Same After Rain Is Over ( Size Of Bamboos 25Mm Dia And 3M To 3.5 M Long ) 1206 Providing And Fixingbamboo Matting Screen For Partition With Bamboo Sticks 1207 Providing Andfixinglioghtening Conductorsystem Comprisingoferecting Air-Termination Consisting Of Tubularcopperrodof25mmdia.1.2Mmthickwithmultiplepointshead1.2Mt.Long ( Heavy Duty ) Welded Orclampedtog.I.Pipepolebgrade50mm Diaofrequiired Lengthwithm.S.Roundbnase Plate25cmdiamand10mmthickatbottomembededin Cement Concrete 1:3:6 Dfoundation Of Size 45 Cm Diam X 45 Cm Height And Providing Earthing Withcopperearthplateofsize60x60x0.3Cmswith Cadmium Plated Nut Bolts To Fixearthing Strip Burried In Specially Prepared Earth Pits 1.5 Metre Belowgroundlevelwith 40Kilogramcharcoal And Salt With Altemate Layers Of Charcoal And Salt And G.I.Pipe 40Mmdia2meterlengthburriedineartheuptoearthlingplatereminingportionabovegroundlevelfor Wateringandrefillingcomcpetenote-Copperstripfropmlighteningconductorisnot Considered In This Item. 1208 Providingandfixingcopperstrip25mmwideand3mmthickforlighteningconductor Including Fixing With Screws Required Scaffoldingetc.Complete Note- Lightening Conductorandearthinfpitsisnot Considered In This Item 1209 Providingand Fixing In Position Alluminium Strips Of Size 50Mm X 3Mm For Nosing The Steps Including Fixing Withscrewsandravalplugs, Bendingandcuttingtotherequiredshapeandsize, Finishingwithpaint, Necessarymortarbeddingof1:3Cementmortartogetexactlineandlevelincludingwateringandcuringtlt 1210 Providing And Fixing Crimped With G.I. Mesh And Size 20 Mm X 20Mm 10 Guage To Iron Angle Frameincludingwelding Crimp Mesh To Angle Frameand Steel Flat, Fixing The Framein Itsoriginalpositionandoil Painting Etc.Complete ( Excluding Cost Of Structural Steel ) 1211 Providig Andfixing Wlededmeshfabricforguniting Ofmeshsize 75Mm X75mm And10 Guage Thick Including Scaffolding Etc.Complete 1212 Providingandfixingweldedmeshfabricforgunitingofmeshsize150mmx150mmand10guagei.E. 3.25Mm Thick Including Scaffolding Etc.Complete 1213 Removing Double Country Tiled Roof With Ridge And With Battens And Stacking The Materials As Directed With Allleads And Liftscomplete Including Removing Wood Work Below Etc. Complete 1214 Removing Planking From Roof Or Ceiling And Stacking Them Sa Directed With All Leads And Liftsetc. Complete 1215 Removing Queen Post Truss From Roof And Stacking The Materials As Directed With All Leads Andlifts Etc. Complets 1216 Removing King Post Truss From Roof And Stacking The Materials As Directed With All Leads Andlifts Etc. Complets 1217 Removingothertype Trussbelow5metresspanfromroofandstackingthematerialsasdirected With All Leads And Lifts Etc. Complets 1218 Dismantlingflat Wooden Or A.C. Sheet Ceilingwith Framework Includingstackingthe Materialsasdirected With All Leadslifts Etc. Complete. 1219 Removing Cloth Ceiling Including Frame Work And Stacking The Materials As Ditected With All Leads, Lifts Etc.Complete 1220 Dismantling Brick Masonry In Mud And Stacking The Materials As Directed With All Leads, Lifts Etc. Complete. 1221 Dismantling Brick Masonry In Limeor Cement Mortar And Stacking Thematerils As Directedwithallleadslifts Etc 1222 Dismantlingstonemasonryinmudincludingstackingthematerialsasdirectedwithallleads, Liftsetc.Complete 1223 Dismantlingstonemasonryinlimeorcementmortarincludingstackingthematerilsas Directed Withall Leadslifts Etc. 1224 Removinglimeorleancementconcreteincludingstackingthespoilsasdirectedwithall Leads, Liftsetccomplete. 1225 Removing Rich Mix Cement Concrete Including Stacking The Spoils As Directed With All Leads, Lifts Etc, Complete. 1226 Removing Brickbatcoba Including Stackingthe Spoilsasdirectedwithallleads, Liftsetc, Complete. 1227 Removingdoorsandwindowswithframesandstackingthematerialsasdirectedwithall Leads, Liftsetc. Complete. 1228 Removingventilatorsandsmallwindowswithframeandstackingthematerialswithallleads, Liftsetc. Complete. 1229 Removing Wooden Or A.C. Partition Including Frame Work And Stack-Ing Thematerials As With All Leads, Liftsetc. Complete. 1230 Removing Teak Woodtrellies Work Withframe Including Stacking Thematerials As Directed With All Leads, Lifts Etc. Complete. 1231 Removing Cement Tiles, Or Marble Or Polishedshahabad Floor Or Dado Without Bed Concrete Including Stacking The Materials As Directed With All Leads, Lifts Etc. Complete 1232 Dismantling Wooden Floorincluding Beams And Joists, Stacking The Materials As Directed With All Leads, Lifts Etc. Complete. 1233 Removing Mudplaster Including Disposing Of The Spoils As Directed With All Leads, Lifts Etc, Complete. 1234 Removing Wire Fencing With Wooden Post And Stacking The Material With All Leads, Lifts Etc. Complete. 1235 Removing Wire Fencing Withiron / C.C. Fencing Postandstacking The Materials As Directedwith All Leads, Lifts Etc. Complete. 1236 Removingironpiperalinghavingwoodenr.C.C.Orc.C.Orironpostandstackingthe Materials Asdirected Etc. Complete. 1237 Removingearthen, Stonewatepipeandstackingthemasdirectedwithallleads, Liftsetc. Complete. 1238 Removingcastironorwroughtironora.C.Pipe Andstackingthemasdirectedwithallleads, Liftsetc.Complete. 1239 Dismantling The R.C.C. Work 1:2:4 And Sorting Out The Materials Such As Steel Etc. As Directed And Stackingthem Within The Specified Lead As Directed Etc. Complete. 1240 Removingnp-2Andnp-3Classpipesincludingstackingatroadsideasdirectedbythe Engineer In Charge. Upto 900Mm Dia. Etc Complete. 1241 Removingnp-2Andnp-3Classpipesincludingstackingatroadsideasdirectedbythe Engineer Incharge. Upto 900Mm Dia And Above. Etc Complete. 1242 Removing Single Country Tiled Roof With Battens And Stacking The Materials As Directed With All Leads And Lifts Etc. Complete. 1243 Removingbattensfromroofandstackingthemasdirectedwithallleadsandliftsetc. Complete. 1244 Removing Matting From Roof And Stackingas Directed With All Leads And Lifts Etc. Complete. 1245 Removing Purlins From Roof Including Stackingas Directed With All Leads , Lifts Etc. Complete. 1246 Removingraftersfromroofincludingthematerials Asdirectedwithallleads, Liftsetc. Complete. 1247 Removingclothpartitionwithframeworkandstackingthematerials Asdirectedwithall Leads , Liftsetc. Complete. 1248 Providingand Fixingjutekantan ( Tarat ) Screen Tothescaffold-Ingforexternalgunitingasdirected Including Removing The Same After The Work Is Over Etc. Complete. 1249 Providing And Erecting Chain Link Fencing 1.6 M. Height Withg.I. Chainlink Of Size 50 X 50Mm, 8Gauge Thickandfixed75mmabovegroundlevelonverticalm.S.Anglesof40x40x6mmsize, Includind Excavating Pits For Foundation And Embedded In C.C. Block Of 1:4:8 Mix Of Size 450 X 450 X 670 Mm. At 1.75M. C / C With Iron Bar 16Mm Dia As Hold Fast Including Welding Link With Angle Frame At 30 Cm C / C With Nuts And Bolts And Horizontal M.S. Angles At Top Andbottom Of 25 X 25 X 5 Mm Size Andvertical M.S. Flat 35 X 5 Mm And25 X 5Mm Horizontal Including Cross Support Of 40 X 40 X 6 Mm Angles Both Side At Every Corner Or Bend Embedded In Concrete Blocks Of 1:4:8Of Size 450 X 450 X 670 Mm Including 3 Coats Of Oil Painting Etc.Complete. 1250 Removing Urinal Pans Or Wash Hand Basins With Frame Including Disconnecting The Sanitary Andwatersupply Connections, Removingthesamecarefullyandstackingtheserviceable Materialsasandwheredirected Includingthrowingtheunserviceablematerialsoutsideetc Complete 1251 Removingw.C.Pansincludingdisconnectingthesanitaryandwatersupplyconnections, Removing And Breaking Flooring And Bed Con-Crete Around Pan Removingthe Same Carefully And Stackingtheserviceable Materialsasadn Wheredirected Includingthrowingthe Unserviceablemateriaslsoutsideetc.Carefully Andthrowingouttherefusaloutsideetc. Complete. 1252 Providingandfixingdoublescaffoldingsystem ( Cuplocktype ) Ontheexteriorsideof Building / Structure, Includingadditionalrowsofscaffoldinginstepped Mannerasper Requirementof Site, Made With 40Mmdia M.S. Tube, Placed 1.5 Metrecentre To Centre, Horizontal& Verticaltubes Joint With Cup & Lock System With M.S. Tubes, M.S. Tube Challis, M.S.Clampsandstaircasesysteminthescaffoldingforworkingplatformetc.Andmaintainingit In A Serviceableconditionforexecutionofworkofcleaningand / Orpointingand / Or Applying Chemical And Removing It Thereafter. The Scaffolding System Shall Be Stiffened With Bracings, Runners, Connecting With Thebuildingetc, Wherever Required, If Feasible, Forinspectionofworkatrequiredlocationswith Essentialsafetyfeaturesfortheworkmenetc., Complete As Per Directions And Approval Of Engineer-In- Charge. Note:- ( 1 ) Theelevational Area Of The Scaffolding Shall Be Measured For Payment Purpose. ( 2 ) The Payment Will Be Made Once Only For Execution Of All Items For Such Works. 1253 Removing Manglore Tiled Roof And Ridge Tiles With Battens, Ridge And Barge Boards, Eaves 8 A Boards Etc And Sacking The Materials As Directed With All Leads Andlifts Complete. Including Removing Wood Work Below Etc.Complete. 1254 Providing And Erecting 1.5 Metre High Wire Fencing With Seven Rows Of Barbed Wire Supported On M.S. Angles ( 50 Mm X 50 Mm X 6 Mm ) At 2.5 Metres Centre To Centre Including Excavating Pits For Foundation, Fixing Posts In Cement Concreteof Size 45 X 45 X 45 Cm, Fastening The Wire And Painting The M.S. Angles With One Coat Ofred Lead Primer And Two Coats Of Painting Etc. Complete. 1255 Providing And Erecting 1.5 Metre High Wire Fencing With Seven Rows Of Barbed Wire Supported Onwooden Post Of Specified Sizeat 2.5 M C / C Including Excavating Pits For Foundation, Fixing Post Incement Concrete 1:4:8 Block Of Concrete Of Size 45 X 45 X 45 Cm Fastening The Wire And Coal Tarring Wooden Post Intwo Coats Etc. Complete. 1256 Replacement Of Damaged Alluminium Butt Hinges Of 125 Mm Of Approved Quality And Make Todoorshutter Including Removing Existing The Same In Original Position Making Properadjustmentforsmooth Operation Etc. Complete As Per Sample Approved By Engineer Incharge. 1257 Replacement Of Damaged Mortise Lock Of Approved Quality And Make To Door Shutterincluding Removing And Refixing With Necessaryscrew, Makingproper Adjustment Forsmooth Operationetc. Complete As Per Sample Approved By Engineer In-Chareg. 1258 Replacement Of Damaged Aldrop 300 Mm Chromium Plated Of Approved Quality And Make To Doorshutterincluding Removing Existing The Same In Original Position Making Properadjustmentforsmooth Operation Etccomplete As Per Sample Approved By Engineer In-Charge 1259 Replacementofdamaged Aldrop300mm Ironoxidisedofapprovedqualityandmake To Doorshutterincluding Removing Existing The Same In Original Position Making Properadjustmentforsmooth Operation Etccomplete As Per Sample Approved By Engineer In-Charge 1260 Replacement Of Damaged Tower Bolt 300 Mmchromiumplated Of Approved Quality Andmaketo Door / Window Shutter Including Removing Existing The Same In Original Positionmaking Proper Adjustmentforsmooth Operationetc.Completeaspersampleapprovedby Engineer In-Charge. 1261 Replacementofdamagedalluminiumhandle125mmofapprovedqualityandmaketo Door / Windowshutterincludingremovingexistingthesameinoriginalpositionmakingproperadjustmentforsmooth Operation Etc. Complete As Per Sample Approved By Engineer In-Charge. 1262 Replacement Of Damaged Lock Of Approved Quality And Make To Cupboard And Doorwerincluding Removing And Refixing With Necessary Screw, Making Proper Adjustment Forsmoothoperationetc.Complete As Per Sample Approved By Engineer In-Charge. 1263 Removing Chockes And Leakages From Down Take G.I / Ci / Pvc Pipe Line On Walls Floor Level By Using Zoola / Scaffolding And Rectify The Same For Functioning With All Liftsetc. Complete. 1264 Manualy Clearing The Chockes From Under Ground Drainage Line Including Inspection Chambers With The Helpof Required Tools For Propre Functioning Line Chamber To Chamber Etc. Complete. 1265 Manualy Clearing By Removeing The Chockes From Nahni Trap, Gully Trap, Wash Basin Unit, Sink And Wcwith The Help Of Required Tools For Proper Functioning The Same Etc. Complete. 1266 Filling Tiles Joint Portion Offlooring And Dado Filling With White Cement By Removing Existingloose Morter / Cement Slurry From Joint With Tools And Finish With Washing Cleaning And Curing Etc. Complete. 1267 Providing And Fixing 6 Mm Thick Commercial Plywood With Jungle Wood Frame Work Of 50 X 35 Mm Size At 60 Cmon Bothwaysforclosingthewindowportion / Openingsforprotectionfromfallingdebris, Dustetc. Including Cutting, Fixingwith Nails And Removing After The Same After Completion Of The Work. ( To Be Usedftl F S Itdi Ei ) 1268 Removalofplants / Ficusgrown By Pulling Outrootsystem Embedded In Masnory, Cutting Stemand Application Of High / Gur / Lime Formulation As Specified By The Architect Or Otherpatentedchemical Biocidetreatment Suchas BiocideGlycel ( Iso Proplaminesalt Of Glyphosate ) Or Other Chemical Asspecified By The Engineer In Charge Etc. Complete. 1269 Lowering Down The Debris Obtainedfrom Breaking And Removing The Cement Plaster / Burnt Brick Masonry Ofthe First Floor By Any Means Without Causing Dust Nuisance And Damage To Structure, Stacking The Same As And Where Directed Including Cleaning The Site Complete. 1270 Providing&Applying Chemical Forcleaningtheexposedsteelstructure, Tmtbars, Etc.Ofstructureby Grindingthesurfacebygrindermachine, Wirebrush, Removingexistingcorrosionfromthemetalalso Removinglooseparticles, Oftheareabywaterjet, ( Usingothermechanical / Manualmeans ) Andapplyon Prepared Surface Ofas Corrosion Preventive Coat On Prepared Tmt Bars, Steel Structure, Metal Surface Etc. To Protect It From Corrosion Etc. As Per ManufacturerSspecification ( Using Othermanual / Mechinicalmeans ) Afterthat Providing Andapplyinghigh Abrasiveresistant, Selfcuring, Uvresistant, Impermeable , High Strength, Nonshrink, Polyironiteceramiccementatious ( Picc ) Repairmortarresurfacingon Concrete Surfaceofthicknessupto10mmincludingbreakinghoneycomb Area, ( Using Manual / Mechanical Means ) , Clean The Concrete Surface With Special Chemical Clononwith Pressure Water Jet For Removing Of Algae Fungi, Applybondcoatkelox Water Misible Epoxy Before Piccapplication Withallleads Andlifts, Material, Machinery, Labour, Scaffolding, Etc.Completeasperspecificationandasdirectedbyengineer-In- Charge. 1271 Providing Andgrouting The Holes By Polyceramiccementitiousi.E Nicgrout G 06 + 53 Grade Cement Material Ofas Per Requirement To Reduce The Porosityof Concrete / Masonry Structure Andto Increase The Strength Of Structure Usinggrouting Pipes , Grouting M / C, Mixer Etc And All Relevant Safety With All Leads And Lifts, Material, Machinery, Labour, Etc. Complete As Per Specification And As Directed By Engineer-In-Charge. 1272 Providing Andapplying High Abrasive Resistant, Uvresistant, Impermeable , Selfcuring, High Strength, Non Shrink, Poly Ironite Ceramic Cementatious ( Picc ) Repair Mortar For Waterproofingon Concrete Surface With Thickness Up To 5 Mm, , Apply Bond Coat Kelox Watermisibleepoxybeforepicc Application ( Usingmanual / Mechanical Means ) And Providingand Applying Pcc Up To 50 Mm Thicknessfordesireslopetodrainthewaterandkept Ponded For Continuous Period Of 3 Days To Detect Any Seepage / Leakage / Dampness If Any, The Surfacethenshallbecleared, Completeasperspecification Includingcostofallmaterials, Machinery, Labour, Insurance Chargesas Directed By The Engineer In Charge. 1273 Picc Coating For Concrete Bridge Repair Work :-Providing And Applying Poly Ironite Ceramic Cementitious ( Picc ) Material Of Self Curing, High Abrasion Resistant , Non Shrink , Highstrength, Uvresistant, Repairmortarcoatingonbondcoatkeloxwatermissableepoxyof Onconcretesurface Upto10mm Thickness Including Cleaning The Concrete Surface Of Bridge By Grinding The Surface By Grinder Machine With Wire Brush / Diamond Wheel, Removing Existing Looseparticlesetc.Byusinggrinder, Wirebrush, Breaker Machine, Waterjet ( Usingother Mechanical / Manualmeans ) Alsoremovingofalgaefungibyspecial Chemical Of Clononetc.Completewithallleadsandlifts, Material, Machinery, Labour, Scaffoldingetc. Complete As Per Specification And As Directed By Engineer-In-Charge. 1274 Removal Of Vegitation / Plants:- Removal Of Entire Root Inside The Bridge Portion. Remains Of The Root Shall Be Treated With Special Chemical Steripure Mbt 20. Top 50 Mm Shall Filled With Highstrengthgrout Including Costofallmaterial, Machinery, Labour, Scaffolding, Etc.Asperspecificationandasdirectedbyengineer-In- Charge. 1275 Providing &Applyingduraclean-Wr Forcleaningthe Tmtbars, Steelstructure Etc.Of Structure By Waterjet Cleaning / Grinding The Surface By Grinder Machine, Wire Brush, Removing Existing Corrosion From The Metal Surface Also Removing Loose Particles ( Using Other Mechanical / Manualmeans ) Andapply On Prepared Surface Of Duraguard - As Corrosionpreventive Coat On Prepared Tmt Bars, Steel Structure, Metal Surfaceetc. To Protect It From Corrosion Etc. Asper ManufacturerSspecification ( Using Othermanual / Mechinical Means ) Complete As Per Specification Including Cost Of All Materials, Machinery, Labour, Insurance Chargesas Directed By The Engineer In Charge. 1276 Picc Filling Forhoney Combing Areaat Concrete Surface:-Providing And Applying Polyironite Ceramiccementitious ( Picc ) Materialofselfcureing , Highabrasionresistant, Nonshrink, High Strength, Uv Resistant, Repair Mortar Coating On Kelox Water Missble Epoxy Of Concrete Surfacefill Thehoney Combingareaetc.Ontackyprimercoatupto10mmthicknessorasperthesurfaceconditionsincluding Cleaningtheconcretesurfaceofbridgebygrindingthe Surface By Grinder Machine Withwire Brush / Diamondwheel, Removingexistingloose Particles Etc. By Using Grinder, Wire Brush, Breaker Machine, Water Jet ( Usingothermechanical / Manualmeans ) Alsoremovingofalgaefungibyspecialchemicalofclonon. Etc.Completewithallleadsand Lifts, Material, Machinery, Labour, Scaffoldingetc.Completeasper Specification And As Directed By Engineer-In-Charge. 1277 Providing And Applying Poly Ironite Ceramic Cementitious ( Picc ) Ofself Curing, A Highabrasion Resistant, Non-Shrink, High Strength, Low Porosity, Uv Resistant Repair Mortar Onconcrete Road Etc Including Cleaning The Concrete Surface On Concrete Road By Breaking, Cleaningwith Wirebrush, Removingexistinglooseparticlesetc.Byusing Wirebrush, Breakermachine, Air ( Usingothermechanical / Manual Means ) Then Applying Kelox ( Water Missible Epoxy ) Of , Bond Coat On Preparedconcrete Surface For Bonding The Old Surface To New Repair Mortar Etc. As Per ManufacturerS Specification ( Using Other Manual / Mechinicalmeans ) Thenapply Repairmortarofpicc Tofilltheconcretesurface Upto15mmcoat Etc.Complete Withall Leadsand Lifts, Material, Machinery, Labour Etc. Completeasper Specification Andas Directed By Engineer-In-Charge. 1278 Providing And Applying Poly Ironite Ceramic Cementitious ( Picc ) Ofself Curing, A Highabrasion Resistant, Non-Shrink, High Strength, Low Porosity, Uv Resistant Repair Mortar Onconcrete Road Etc Including Cleaning The Concrete Surface On Concrete Road By Breaking, Cleaningwith Wirebrush, Removingexistinglooseparticlesetc.Byusing Wirebrush, Breakermachine, Air ( Usingothermechanical / Manual Means ) Then Applying Kelox ( Water Missible Epoxy ) Of , Bond Coat On Preparedconcrete Surface For Bonding The Old Surface To New Repair Mortar Etc. As Per ManufacturerS Specification ( Using Other Manual / Mechinicalmeans ) Thenapply Repairmortarofpicc Tofilltheconcretesurface Upto25mmcoat Etc.Complete Withall Leadsand Lifts, Material, Machinery, Labour Etc. Completeasper Specification Andas Directed By Engineer-In-Charge. 1279 Providing And Applying Poly Ironite Ceramic Cementitious ( Picc ) Ofself Curing, A Highabrasion Resistant, Non-Shrink, Highstrength, Lowporosity, Uvresistantcoatingmortaron Existinggsbof100 Mm Thickness, Getlevelledthesurfaceand Curethenapplying Self Curing Coating Picc Mortarfor 50 Mmthicknessafterstampthesurfacebyspecialconcretestamping Mold As Per Specified Texture And Colouretc.Completewithallleadsandlifts, Material, Machinery, Labour Etc. Complete As Per Specification And As Directed By Engineer-In- Charge. 1280 Masonry Bridgerepair Work:-Providingpointingon Masonrysurfaceof Bridgewith Uvresistance, Non-Shrink.Highstrength, Highabrasion, Materiallikepolyironiteceramic Cementitious ( Picc ) Self Curingcementitious Material For Masonry Joint Filling To Depth Of 20Mm Including Pointing Workofmasonry Byremoving Ofexisting Looseportionofstone Masonry By Braking Removing Existing Loose Particles Upto Requireddepth 50Mm Oraspersiteconfition Cleaning With Special Chemicals Clonon And Water Jet Under Pressure Forremovingalgae, Fungi, Applyingbondcoatkeloxwatermissableepoxybeforerepair Materialapplicationcompleteasperspecificationincludingcostofallmaterial, Machinery, Labour, Scaffolding, Transportationetc.Withallleadsandliftsasdirectedbythe Engineer-In- Charge. 1281 Providing&Applying Duraclean-Wr -Forcleaningthetmtbars, Steelstructureetc.Ofstructureby Waterjet Cleaning / Grinding The Surface By Grinder Machine, Wire Brush, Removing Existing Corrosion From The Metal Surface Also Removing Loose Particles ( Using Other Mechanical / Manualmeans ) Andapply On Prepared Surface Of Duracap 2 Coats Corrosionpreventive Coat On Prepared Tmt Bars, Steel Structure, Metal Surfaceetc. To Protect It From Corrosion Etc. Asper ManufacturerSspecification ( Using Othermanual / Mechinical Means ) Complete As Per Specification Including Cost Of All Materials, Machinery, Labour, Insurance Chargesas Directed By The Engineer In Charge. 1282 Providing And Applying Poly Ironite Ceramic Cementitious ( Picc ) Ofself Curing, A Highabrasion Resistant, Non-Shrink, Highstrength, Lowporosity, Uvresistantrepairmortartofillthepotholeson Concrete / Bitumen Road Including Cleaning The Pot Holes On Concrete / Bitumen Road By Breaking, Cleanwith Wirebrush, Airblower, Removingexistinglooseparticlesetc.Byusing Wirebrush, Breaker Machine, Air Jet ( Usingother Mechanical / Manualmeans ) Thenapplyingkelox Watermissiableepoxybondcoaton Prepared Concrete / Bitumen Surfacepotholefor Bondingtheoldsurfacetonewrepairmortaretc.Asper ManufacturerS Specification ( Using Other Manual / Mechinical Means ) Then Applyrepair Mortarto Fill The Pot Holeson Concrete / Bitumensurfaceupto 75 Mm Depthto Match Existing Road Thickness Etc. Complete With All Leads And Lifts, Material, Machinery, Labour Etc. Complete As Per Specification And As Directed By Engineer- In-Charge. 1283 Providing And Applying Poly Ironite Ceramic Cementitious ( Picc ) Ofself Curing, A Highabrasion Resistant, Non-Shrink, Highstrength, Lowporosity, Uvresistantrepairmortartofillthepotholeson Concrete / Bitumen Road Including Cleaning The Pot Holes On Concrete / Bitumen Road By Breaking, Cleanwith Wirebrush, Airblower, Removingexistinglooseparticlesetc.Byusing Wirebrush, Breaker Machine, Air Jet ( Usingother Mechanical / Manualmeans ) Thenapplyingkelox Watermissiableepoxybondcoaton Prepared Concrete / Bitumen Surfacepotholefor Bondingtheoldsurfacetonewrepairmortaretc.Asper ManufacturerS Specification ( Using Other Manual / Mechinical Means ) Then Applyfast Seting Repair Mortarto Fill The Pot Holeson Concrete / Bitumensurfaceupto 75 Mm Depthto Match Existing Road Thickness Etc. & Movementthevechicalwithin1hour.Completewithallleadsandlifts, Material, Machinery, Labour Etc. Complete As Per Specification And As Directed By Engineer-In-Charge. 1284 Providingandapplying 30Mmthickselfcuringceremicpolymermicroconcreteof Approvedmake Having Compressive Strength Above M30, Nonshrink, Impermeable , Filling Mortarto Load Carrying R.C.C Memberintwolayersoncleanedconcrete Surface, Includinghoneycombarea ( Usingmanual / Mechanical Means ) . Mixingmortar Of Nicosil C80 And Fresh 53 Grade Cement With Required Water Cement Ratio For Desired Consistency And Applying And Finishing By Manual Trawelling , Curing After Curing Initial Setting Time Etc, As Per Manufacturers Specification Etc. Complete As Per Specification And As Directed By Engineer- In- Charge. Work Shall Be Executed By Certified Applicator Only And Work Shall Be Guaranteed For 5 Years And Guarantee Shall Be Providedonrs. 500 / - Stamp Paper. ( Bond Coat Mentioned Below Is To Be Done Before Coating ) 1285 Providing Andapplying Keloxr101 ( Resin ) + Keloxh404 ( Hardner ) Water Misible Epoxy Of Approved Makefor Bonding Old Concrete To New Moratr After Mixingslowely In Predefined Ratio And Applying By Brush Onthesurface, Whenitistackythenapplythemoratrcompleteasperspecificationandasdirectedby Engineer-In-Charge. Work Shall Be Executed By Certified Applicator Only And Work Shall Be Guaranteed For 5 Years And Guarantee Shall Be Provided On Rs. 500 / - Stamp Paper 1286 Corrosion Protection Of Unexposed Old Reinforcement On Non-Spalled Concrete By Insertion Of Sustained Release Corrosioninhibitingcapletslikepowrthrowwhichprotectbothanodic&Cathodicsitesandreduces Corrosion Potential Ecorr By Minimum 80 Mv In Conductive Medium, By Drilling 20-22 Mm Dia Holes Into The Concrete At A Depth Of 30-40 Mm And Inserts To Befilled By Epoxy Sealant Epco-1010.Caplets Shall Inhibit Corrosion Inhibition Efficiency Of 98% ( When Added 0.03 % By Weight ) Against Control Sample Evaluated By Tafelpolarizationmethod.Depthofpenetrationforeffectivecorrosionprotectionshallbe120mm&Film Formation Of 20 Microns As Evaluated By Csir-Cecri Karaikudi.Spacing Of Powrthrow Shall Be-A ) Forrcccolumns-1Unitsinasingledrilledhole Ataspacing Of1m C / Cfrom Twoopposite Facesin Staggered Fashionb ) Forrccbeams-1Unitsinasingledrilledhole Ataspacingof1mc / C Fromtwooppositefacesin Staggered Fashionc ) Rcc Slab- 4 Units In A Single Drilled Hole In 1 Sqm Area In A Grid Pattern 1287 Providing Protection Of Unexposed Old Reinforcement On Non Spalled Concrete By Insertion Of Sustained Release Corrosioninhibitor Caplets Like Powrthrow Sustainedrelease Corrosioninhibiting Caplets Ofto Protect Bothanodic&Cathodicsitesandshallreducetoreducecorrosionpotentialecorrbyminimum80mvin Conductive Medium, By Drilling 20 Mm Holes Into The Concrete At A Depth Of 25 Mm And Inserts To Be Filles By Epco-Pc-Putty. Caplets Shall Inhibit Corrosion Inhibition Efficiency Of 98% ( When Added 0.03% By Weight ) Against Control Sample Evaluated By Tafel Polarizationmethod. Depthof Penetrationfor Effective Corrosion Protection Shall Be 120 Mm And Film Formation Of 20 Microns As Evaluated By Csir-Cecri Karaikudi. 1288 Providingandapplyingelastomeric, Anticarbonation, Anticorrosive, Uvresistant, Solventbasedpure Aliphaticacrylatesystem-Monopol456ontheexteriorfacesofbuildingsprotectionagainstion Penetration, Carbonation, Uvradiationsandwetheringeffectconformingtoastmd4541-02Having Electrochemical Impedance Of 107Oand Achieving Dry Film Thickness Of Minimum 200 Microns In A Primer Coat Followed By Two Top Coats Using Brush Or Spray After Complete Cleaning & Removal Of Oil, Grease Or Loose Particles From The Surface Etc. Complete. 1289 Waterproofing Treatmenttoexisting Terraceby Using Polymeric Cementitious Membrane Of Approved Make & Approved By Engineer In Charge By Replacing The Existing Waterproofing Treatment. Break Open The Existingi.P.S. And Brick Bat Coba Of The Terrace Slab To Expose The Bare Slab. ( If There Are Cracks On The Bare Slab Open The Crack In V Groove And Fill It With P.M.M. And If There Are Lots Of Honeycombs And Identified Bad Patches Of Concrete The Same Should Be Grouted By Grouting Procedures ) . Clean The Entire Surface Thoroughlyand Over Thispreparedsurface, Apply Three Coats Of Polymeric Waterproofing Coating Having A Breathable Nontoxic Acrylicpolymerliquidofapprovedmake&Approvedbyengineerincharge, Overthiswaterproofing Treatment, Provide And Lay Brick Bat Coba Of Average 112 Mm Thickness. 1290 Waterproofingtreatmenttoexistingtoiletandbathroomsbyusingpolymericcementitiousmembraneof Approved Make & Approved By Engineer In Charge And Replacing The Existing Waterproofing Treatment. Break Open The Existing I.P.S. And Brick Bat Coba Of The Toilet And Bathroom Areas To Expose The Bare Slab. ( If There Arecracksonthebareslabopenthecrackinvgrooveandfillitwithp.M.M.Andiftherearelotsof Honeycombsandidentifiedbadpatchesofconcretethesameshouldbegroutedbygroutingprocedures ) . Cleantheentiresurfacethoroughly Andoverthis Preparedsurface, Apply Threecoatsofpolymeric Waterproofingcoating Havinga Breathablenontoxicacrylicpolymerliquid Ofapprovedmake& Approved By Engineer In Charge Overthis Waterproofingtreatment, Provide And Lay Brick Bat Coba Of Average 112 Mm Thickness. 1291 Clean The Deck Surface Of The Bridge Of All Loose Particles, Dust, Cement Laitance Etc. Preferably Done By Using Machine Like Device. Inspect For Cracks / Construction Joints. Fill The Cracks By Flexiroof Pu Of Approved Make & Approved By Engineer In Charge ( This Coating Is To Be Protected By Providing Ips On Top Of It ) . Provide And Applyaprimercoatof Flexiroofpuprimerofapprovedmake &Approvedbyengineerincharge Onthe Cleaned Rcc Deck Surface Using A Soft Paint Brush. Shake The Container Well And Directly Apply The Primer By Brush. Allow It To Set For 30 - 45 Mins.Provide And Apply Flexiro Of Pu Of Approved Make & Approvedby Engineer In Charge By Brush, Roller Or Airless Spray Equipment. Apply At A Rate Of 1 Kilogram / Square Metre For The First Coat Evenly Over The Primer Surface And Allow To Set For 12 Hours. After Ensuring That The First Coat Is Set And Cured, Apply The Second Coat In Similar Manner At A Rate Of 0.5 Kilogram / Square Metre And Allow To Set. While The Second Coat Is Has Reasonably Hardened But Still Wet And Tacky On Surface, Sprinkle Sand Over The Surface To Make It Rough So As To Provide Mechanical Key For The Protective Screed / I.P.S. Ensure That The Sand Does Not Gets Embedded In The Second Coat And Remains On The Surface. Allow The Two Coats Of Flexiroof Pu Of Approvedmake&Approvedbyengineerinchargetoaircurefor4-5Daysbeforeproceedingwiththe Protective Screed. This Shouldbe Followedby Applicationof Compatible I.P.S.Of 25Mmthickwaterproof Bedding Of I.P.S. The Liquid Membrane Should Have A Track Record Of Atleast 4 Years In India & Gulf Region And Have Atleast An 4 Year Track Record In Pwd.Single Component, Liquid Applied, Polyurethane Membrane Should Have Following Minimum Properties:1. Water Permeability ( Din 1048 ) : Nil As Per Din 1048 @ 7 Bar Of Hydrostatic Pressure.2. Moisture Permeability: < 0.4 G / M2 / Day3.Accelerated Weathering ( Is 101 ) : 2000 Hrs No Cracking Or Blister Formation.4. Adhesion To Concrete ( Astm D 1000 ) : >21 Kilogram / Cm2 ( Concrete Fails ) 5. Tensile Strength: > 2.0 Mpa ( Astm D412 ) 6. Should Not Be Water Soluble Or Water Dilutable 1292 Clean The R.C.C. Roof Slab Surface Of All Loose Particles, Dust, Cement Laitance Etc. Preferably Done By Using Machine Like Device. Inspect For Cracks / Construction Joints. Fill The Cracks By Flexiroof Pu Of Approved Make & Approved By Engineer In Charge ( This Coating Is To Be Protected By Providing I.P.S. On Top Of It ) . Provide And Apply A Primer Coat Of Flexiroof Pu Primer Of Approved Make & Approved By Engineer In Charge On The Cleaned Rcc Deck Surface Using A Soft Paint Brush. Shake The Container Well And Directly Apply The Primer By Brush. Allow It To Set For 30 - 45 Mins. Provide And Apply Flexiroof Pu Of Approved Make &Approved By Engineer In Charge By Brush, Roller Or Airless Spray Equipment. Apply At A Rate Of 1 Kilogram / Square Metre For The First Coat Evenly Over The Primer Surface And Allow To Set For 12 Hours. After Ensuring That The First Coat Is Set And Cured, Apply The Second Coat In Similar Manner At A Rate Of 0.5 Kilogram / Square Metre And Allow To Set. While The Second Coat Is Has Reasonably Hardened But Still Wet And Tacky On Surface, Sprinkle Sand Over The Surface To Make It Rough So As To Provide Mechanical Key For The Protective Screed / Ips. Ensure That The Sand Does Not Gets Embedded In The Second Coat And Remains On The Surface. Allow The Two Coats Of Flexiroof Pu Of Approvedmake& Approvedbyengineerinchargetoaircurefor4-5Daysbeforeproceedingwiththe Protectivescreed.Thisshouldbefollowedbyapplicationofcompatibleipsof25mmthickwaterproof Bedding. The Liquid Membrane Should Have A Track Record Of Atleast 4 Years In India & Gulf Region And Have Atleast An 4 Year Track Record In Pwd.Single Component, Liquid Applied, Polyurethane Membrane Should Have Following Minimum Properties:1. Water Permeability ( Din 1048 ) : Nil As Per Din 1048 @ 7 Bar Of Hydrostatic Pressure.2. Moisture Permeability: < 0.4 G / M2 / Day3.Accelerated Weathering ( Is 101 ) : 2000 Hrs No Cracking Or Blister Formation.4. Adhesion To Concrete ( Astm D 1000 ) : >21 Kilogram / Cm2 ( Concrete Fails ) 5. Tensile Strength: > 2.0 Mpa ( Astm D412 ) 6. Should Not Be Water Soluble Or Water Dilutable 1293 Cleantherccroofslabsurfaceofalllooseparticles, Dust, Cementlaitanceetc.Preferablydoneusing Machinelikedevice.Inspectforcracks / Constructionjoints.Fillthecracksbyelastoroofpuofapproved Make &Approved By Engineer In Charge. Provide And Apply A Primer Coat Of Sunprime Pu Primer Of Sunanda Or Equivalent Or Approved By Engineer In Charge On The Cleaned Rcc Slab Surface Using A Soft Paint Brush. Shake The Container Well And Directly Apply The Primer By Brush. Allow To Set For 30 - 45 Mins Depending On The Ambient Temperature. After The Primer Has Totally Cured And Dried, Apply Elastoroof Pu Of Approved Make & Approvedbyengineerinchargebybrush, Rollerorairlesssprayequipment.Applyatarateof1 Kilogram / Square Metre For The First Coat Evenly Over The Primer Surface And Allow To Set For 12 Hours. After Ensuringthatthefirstcoatissetandcured, Applythesecondcoatinsimilarmanneratarateof0.5 Kilogram / Square Metre And Allow To Set. While The Second Coat Is Has Reasonably Hardened But Still Wet And Tackyonsurface, Sprinkle Sandoverthesurface Tomake Itroughsoastoprovide Mechanicalkeyforthe Protective Screed / I.P.S. Of 25 Mm Thick Waterproof Bedding. Ensure That The Sand Does Not Gets Embedded In Thesecondcoatandremainsonthesurface.Allowthetwocoatsofelastoroofpuofapprovedmake& Approved By Engineer In Charge To Air Cure For 4-5 Days Before Proceeding With The Protective Screed. Single Component, Liquid Applied, Polyurethane Membrane Should Have Following Minimum Properties:1. Specific Gravity: 1.30 ± 0.12. Elongation %: >600 1294 Providingandapplyingtwocoatsofprotectivemembraneoverthecuredconcretesurfaceliker.C.C. Footings, Columns, Plinth Beams Etc. Which Will Be Submerged Under Soil So As To Protect The Same. Apply Two Pack Coal Tar Epoxy System Of Sunepoxy Coaltar Of Approved Make & Approved By Engineer In Charge, Having Solid Content Ranges From 80-100%, Tack Free Time 4-6 Hrs. Recoat After 16-24 Hrs.Mix Part A And Part B Of Sunepoxy Coaltarof Approved Make & Approved By Engineer In Charge In 1:1 Ratio With Slow Speed Stirrer And Apply The Same On A Clean R.C.C. Surface By Brush. Allow To Set For 8-10 Hours And Apply The Second Coat. The Rate To Include For Applicationat All Levels To Various Rccelements To The Satisfactionofthe Eicetc. Complete. 1295 Providing&Supplyingcorrosioninhibitingadmixtureinconcretetoprotectsteelbarsforallconcretein Every Part Polyalk Cp 293Of Approved Make &Approved By Engineer In Charge Migrating, Non-Nitrite Based Corrosion Inhibiting Admixture Shall Be Added At A Dose Of 3 Kilograms Per Cum Of Concrete. The Admixture Shouldprotectbothcathodicandanodicsitesandhavebeenaccreditedbyindianroadscongress, Recommended For Use By Ministry Of Road Transport & Highways And Should Have A 4 Year Track Record Of Useinboththegulfregionandindia.Admixtureshouldhaveevaluatedtestreportsdemonstratinga Corrosion Rate Of Zero Coulombs After 9 Test Cycles As Per Astm G 109 When Tested From A Research Institution Nba Accredited Grade A And Internationally Ranked Among Top 5 Research Institutions In The World In Annual Surveyconductedbygeorgiainstituteoftechnologyrankingofresearchinstitutions.Phofadmixture Should Be Alkaline In Nature, Specific Gravity Of 0.99–1.1, Colour : Brownish. The Contractor Must Intimate The Engineer In Charge Prior To Addition In Concrete For Recording. If The Admixture Is Put In The Concrete Mix At The Batchingplant, Awrittenrecordoftheamountofadmixtureusedshallbesuppliedtotheengineer.The Engineermustensurethatthespecifieddosageofadmixtureisaddedintheconcretemix. ( Materialcost Analysis Only ) 1296 Providingandmixingshrinkagecompensatingadmixturecumplasticizer–Sunplex330gmspouch Of Approvedmake& Approvedbyengineerincharge, Addingper50kilogrambagofcementinsandfaced Cement Plaster To Internal / External Surfaces In Finished In Proper Line And Level. Add Sunplex In Dry Machine Mix Before Addition Of Gauging Water. ( Material Cost Analysis Only ) 1297 Providing And Applying One Pack Bonding Coat Between Concrete Members Like Rcc Slabs, Columns, Beams, Chajjas, Pardisetcandcementmortarplasterusinghackaidplast Ofapprovedmake&Approvedby Engineer In Charge. Clean The Concrete Surface Thoroughly To Remove Dust, Dirt, Grime, Deshuttering Oils And Rub Down To A Clean Surface. Apply Hack Aid Plastof Approved Make &Approved By Engineer In Charge By Spray On The Entire Concrete Surface. Provide A Lean Cement - Sand Dash Coat Over The Same. Allow The Dash Coat To Set For Around 24 Hours. Further Plastering As Per Specifications Can Continue. 1298 Clean The Surface To Remove Dirt, Loose Particles. Examine The Surface Closely For Any Cracks. Clean The Cracks. Provideandfillapureacrylic, Polymermodifiedreadytousepastepolyfillar Ofapprovedmake& Approved By Engineer In Charge Having A Cream Coloured Viscous Emulsion Ready To Use Acrylic Polymeric Non- Shrinkcrackfillerputtywithautosuctionpropertiesandrequiringnobondingagent, Nocuringandno Requirement For Opening The Existing Cracks Finishing With Subsequent Filling As Required. Provide And Apply Threecoatsof100%Acrylicwaterproofheatinsulatingbreathable Decorativeexternalcoatingsunext8 Of Approvedmake & Approvedby Engineer Incharge, Inthe Desiredshade. Stir Wellandapplyby Brushfor Three Coats. Applying Three Coats At An Interval Of 4-6 Hours Between Each Coat.High Performance 100% Acrylic, Waterproof, Anti-Fungal, Anti-Carbonation, Heat Insulating External Paint Should Have Following Minimum Properties:1. Specific Gravity: 1.3 ± 0.1 At 25°C 2. Ph: 7.0 To 10.003. Viscosity: 18 To 30 Sec. At 25°C By Ford Cup Number B-4 ( Dilute 2 Parts Of Product With 1 Part Of Water ) 4. Co2 Diffusion Resistance Co- Efficient ( Din En 1062-6 ( 2002-10 ) : 7.59 X1055. Co2 Diffusion Equivalent Air Layer Thickness ( Din En 1062-6 ( 2002-10 ) : 127M @ 190 Microns Dft6. Adhesion ( Astm D 4541 ) : 2.3 N / Mm2 ( Concrete / Substrate Failure ) 7. Solar Reflectance Index ( Astm E 1980 11, En 673:2011, En 410:2011 ) : 107 It Shall Be Applied As Per Manufacturers Specification. 1299 Providingandfixingfactorymadedoor / Windowframesofrequiredcolourmadewithwoodpolymer Composite ( Wpc ) Extuded Internal Ribbed Sections Conforming To American Society For Testing And Materials ( Astm ) In Regard With Density, Tensile Strength, Flexural Strength, Izod Impact, Water Absorption And Screw Withdrawal Strength With Wall Thickness Of 5Mm ( + / 1Mm ) And With Frames Having Mitred Joints At Each Corner, Joinedtogetherbytwonos.Of10x8mm &40Mm Longpvcdovetailkeysincludinghardwoodpiece Support Along The Full Vertical And Horizontal Length In Rebate Portion Hole For Fixing Hinges And Fixtures And The Frames Fixed To Walls / Columns With 15 Mm Long Dash Fasteners / Holdfasts ( Dash Fasteners / Holdfasts To Be Paidseparately ) Etc.Completeasperthedirectionofengineerincharge, Withpriorapprovalofconcerned Superitending Engineer. 1.1. For Profile Size Of 75 X 50 Mm With 32 X 12 Mm Rebate 1300 Providingandfixingfactorymadedoor / Windowframesofrequiredcolourmadewithwoodpolymer Composite ( Wpc ) Extuded Internal Ribbed Sections Conforming To American Society For Testing And Materials ( Astm ) In Regard With Density, Tensile Strength, Flexural Strength, Izod Impact, Water Absorption And Screw Withdrawal Strength With Wall Thickness Of 5Mm ( + / 1Mm ) And With Frames Having Mitred Joints At Each Corner, Joinedtogetherbytwonos.Of10x8mm &40Mm Longpvcdovetailkeysincludinghardwoodpiece Support Along The Full Vertical And Horizontal Length In Rebate Portion Hole For Fixing Hinges And Fixtures And The Frames Fixed To Walls / Columns With 15 Mm Long Dash Fasteners / Holdfasts ( Dash Fasteners / Holdfasts To Be Paidseparately ) Etc.Completeasperthedirectionofengineerincharge, Withpriorapprovalofconcerned Superitending Engineer. 1.2For Profile Size Of 100 X 50 Mm With 32 X 12 Mm Rebate 1301 Providingandfixingfactorymadedoor / Windowframesofrequiredcolourmadewithwoodpolymer Composite ( Wpc ) Extuded Internal Ribbed Sections Conforming To American Society For Testing And Materials ( Astm ) In Regard With Density, Tensile Strength, Flexural Strength, Izod Impact, Water Absorption And Screw Withdrawal Strength With Wall Thickness Of 5Mm ( + / 1Mm ) And With Frames Having Mitred Joints At Each Corner, Joinedtogetherbytwonos.Of10x8mm &40Mm Longpvcdovetailkeysincludinghardwoodpiece Support Along The Full Vertical And Horizontal Length In Rebate Portion Hole For Fixing Hinges And Fixtures And The Frames Fixed To Walls / Columns With 15 Mm Long Dash Fasteners / Holdfasts ( Dash Fasteners / Holdfasts To Be Paidseparately ) Etc.Completeasperthedirectionofengineerincharge, Withpriorapprovalofconcerned Superitending Engineer. 1.3 For Profile Size Of 125 X 50 Mm With 38 X 12 Mm Rebate 1302 Providingandfixingfactorymadedoor / Windowframesofrequiredcolourmadewithwoodpolymer Composite ( Wpc ) Extuded Internal Ribbed Sections Conforming To American Society For Testing And Materials ( Astm ) In Regard With Density, Tensile Strength, Flexural Strength, Izod Impact, Water Absorption And Screw Withdrawal Strength With Wall Thickness Of 5Mm ( + / 1Mm ) And With Frames Having Mitred Joints At Each Corner, Joinedtogetherbytwonos.Of10x8mm &40Mm Longpvcdovetailkeysincludinghardwoodpiece Support Along The Full Vertical And Horizontal Length In Rebate Portion Hole For Fixing Hinges And Fixtures And The Frames Fixed To Walls / Columns With 15 Mm Long Dash Fasteners / Holdfasts ( Dash Fasteners / Holdfasts To Be Paidseparately ) Etc.Completeasperthedirectionofengineerincharge, Withpriorapprovalofconcerned Superitending Engineer. 1.4For Profile Size Of 120 X 50 Mm With 32 X 12 Mm Double Rebate ( Window Section ) 1303 Supply&Fixingof Rectifiedporcelainstonewaretilesforventilatedfacadesofspecifiedsizeasper Specification / Site Drawings Having 6 Mm And 9 Mm Thickness With Factory Made Kerfs ( Grooves ) As Per Need Andsize 600 / 1200And800 / 1600.Therectifiedporcelainstoneware Tiles Shall Possess Properties Having Water Absorption < 0.5% Bending Strength > 40 N / Mm2 And Are Resistant To : Uv Light, Chemicals, Smog, Thermalshocks&Bacteria.Thefacadewillbemadefromnexionrectifiedporcelainstonewaretiles ( Sinteredcompactsurfaces ) Specifiedasperiso13006:Annexg-En14411:Annexg: Drypressed Ceramic Tiles And All The Tests Carried Out By Italian Labs Accredited According To Iso / Iec 17025 : 2005. The Terramilanofixingsubstructurewillconfirmtonormetecnicheperlecostruzionintc / 8 ( Technical Standardfor Construction ) Guidelines For Constructioninitaly, Eurocode 0Informationonthe Methodof Semi-Probabilistic Limit States And Safety Factor Euro Coad 1 Determination And Calculation Of Actions On Structure Euro 9 Project Aluminum Structures Uni 11018 And Etag 034 The Substructure Will Consists Of Upright Extruded Aluminum Profile Trust80, Alloy 6060 T5 Thickness Equal To 1.5 To 2 Mm And Dimension 80 X 110 Mm, Inter Axis 80 Cm Of Length 3660 Mm, 8085 Aluminum Box Section Of 1 X 3 Inch, 1X2inch And 1X5inchoflength3660mm Andthickness1.5To2mm Asperneed.Bracketsst80galvanizedsteeland Aluminum Of 80 Mm X 60 Mm, Aluminum L Bracket Size 1.5 X 1.5 Inch And 1 X 2.5 Inch Thickness 3 Mm That Allow To Anchor The Vertical Stand To The Building, 9 Mm / 6Mm S10 Hooks Harmonic Stainless Steel Aisi 304 Which Supports The Weight Of The Tiles; Bossong / Hilti Mechanical Fasteners Andnylon Anchor Fastner; And Structural Sealant Of 3M For Ventilated Facade. Packing Of Edges And Corner With Window Seal With Acp Of Appoved Make For Water Proofing And Alteration. Inclusive Of Scaffolding And Fixing. The Installation Method Differ According To The Structure Of Building And Design. For External And Internal Cladding Of Structure. With Prior Approval Of Concerned Superitending Engineer. 1304 Supply & Fixing Ofrock / Stone Finished Outdoor Vitrified Flooring Tiles 20 Mm Thick And Required Width Wide In Plain Pattern Includingcement Float, Filling Joints, With Neat Cement Slurry, Natural Sand, Curing And Cleaning Complete. With Prior Approval Of Concerned Superitending Engineer. 1305 Supply & Fixing Ofrock / Stone Finished Outdoor Vitrified Flooring Tiles 16 Mm Thick And Required Width Wide In Plain Pattern Includingcement Float, Filling Joints, With Neat Cement Slurry, Natural Sand, Curing And Cleaning Complete. With Prior Approval Of Concerned Superitending Engineer. 1306 Supply & Fixing Ofrock / Stone Finished Outdoor Vitrified Flooring Tiles 16 Mm Thick And Required Width Wide In Plain Pattern Includingcement Float, Filling Joints, With Neat Cement Slurry, Natural Sand, Curing And Cleaning Complete With Prior Approval Of Concerned Superitending Engineer. 1307 Supply & Fixing Offull Body Vitrifid Steptiles Ready To Install Treads Andrisers 16Mm Thick, Required Widthandrequiredfinishinplainpatternincludingcementfloat, Fillingjoints, Withneatcementslurry, Natural Sand, Curing And Cleaning Etc Complete. With Prior Approval Of Concerned Superitending Engineer. 1308 Supply & Fixing Offull Body Vitrifid Steptiles Ready To Install Treads Andrisers 12Mm Thick, Required Widthandrequiredfinishinplainpatternincludingcementfloat, Fillingjoints, Withneatcementslurry, Natural Sandcuring And Cleaning Etc Complete. 1309 Supply & Fixing Of Rock / Stone Finished Full Body Vitrifid Steptiles With Thick Bullnose For Ready To Install Treads And Risers, 16 Mm Thick And Of Required Widthin Plain Pattern Including Cement Float, Filling Joints, Withneatcementslurry, Naturalsand, Curingandcleaningcomplete.Withpriorapprovalofconcerned Superitending Engineer. 1310 Supply & Fixing Of Rock / Stone Finished Full Body Steptiles Stonevitrifid Tiles With Thick Bullnose For Ready To Install Steps And Risers12 Mm Thick And Required Width Wide In Plain Pattern Includingcement Float, Filling Joints, With Neat Cement Slurry, Natural Sand, Curing And Cleaning Complete. With Prior Approval Of Concerned Superitending Engineer. 1311 Providinghotdipgalvanizingconformingtois12594-1988Toreinforcementbars, Havingmassofzinc Coatingshallnotbelessthan610grm / Squaremetreofbarsurfaceareafactorycontrolprocesswith Degreasing, Rinsing, Acidpickling, Againrinsing Afterpicking, Fluxing, Hotdipgalvanizing Inmolten Zinc Bath Having Zinc Purity Of Bath Minimum 98.5% Quenching & Passivation Process.32 Mm To 40 Mm Dia. With Prior Approval Of Concerned Superitending Engineer. 1312 Providinghotdipgalvanizingconformingtois12594-1988Toreinforcementbars, Havingmassofzinc Coatingshallnotbelessthan610grm / Squaremetreofbarsurfaceareafactorycontrolprocesswith Degreasing, Rinsing, Acidpickling, Againrinsing Afterpicking, Fluxing, Hotdipgalvanizing Inmolten Zinc Bath Having Zinc Purity Of Bath Minimum 98.5% Quenching & Passivation Process.16 To 25 Mm Dia With Prior Approval Of Concerned Superitending Engineer. 1313 Providinghotdipgalvanizingconformingtois12594-1988Toreinforcementbars, Havingmassofzinc Coatingshallnotbelessthan610grm / Squaremetreofbarsurfaceareafactorycontrolprocesswith Degreasing, Rinsing, Acidpickling, Againrinsing Afterpicking, Fluxing, Hotdipgalvanizing Inmolten Zinc Bath Having Zinc Purity Of Bath Minimum 98.5% Quenching & Passivation Process.8 To 12 Mm Dia With Prior Approval Of Concerned Superitending Engineer. 1314 Providingandconstructingnonloadbearingwallwith200mmhorizontallyperforatedthermoclay Hollowblocks Withcompressivestrengthnot Less Than35kilogram / Sqcm, Uvalue Of 0.60 W / M2k, Water Absorption Of 15% Mansonryto Be Done Using Sand Cement Mortar 1:6 With Blocks Of Size 400Mm X 200 Mm X 200 Mm ( 12.5 Brick Per Square Metre. Excluding Mortar Joint Thickness ) Including Cost Of Material, Labour Charges, Scaffolding, Curing At All Height, Complete As Perspecification&Directions Ofengineer Incharge. Cost Shall Be Inclusive Of Filling The Blocks With Cement Mortar At Exposed Junctions And Filling With Concrete Using 12Mm Downsize Aggregatesatwindowanddoorjambsforfixing Holdfast.Anchorsetc.Itmustbe Greenbuildingcertifiedfromigbcandgrihaandshouldcomplyiscode3952withpriorapprovalof Concerned Superitending Engineer. 1315 Providingandconstructing Nonloadbearingwallwith150mmhorizontallyperforatedthermoclay Hollowblocks Withcompressivestrengthnot Less Than35kilogram / Sqcm, Uvalue Of 0.60 W / M2k, Water Absorption Of 15% Mansonryto Be Done Using Sand Cement Mortar 1:6 With Blocks Of Size 400Mm X 150 Mm X 200 Mm ( 12.5 Brick Per Square Metre. Excluding Mortar Joint Thickness ) Including Cost Of Material, Labour Charges, Scaffolding, Curing At All Height, Complete As Perspecification&Directions Ofengineer Incharge. Cost Shall Be Inclusive Of Filling The Blocks With Cement Mortar At Exposed Junctions And Filling With Concrete Using 12Mm Downsize Aggregatesatwindowanddoorjambsforfixing Holdfast.Anchorsetc.Itmustbe Greenbuildingcertifiedfromigbcandgrihaandshouldcomplyiscode3952withpriorapprovalof Concerned Superitending Engineer. 1316 Dry Wall Cladding With Clay Tile; Designing, Supplying And Fixing Ofclay Tile Of Wienerberger ( Red Series Or Greyseries ) Orequivalentwithsuitable Size Andthicknessnot Lessthan20mm Asper Manufacturerwith Approved Colour And Pattern With Composition Of Finest Powdered Clay And Colour Mixtures. The Clay Tile Shall Be Fixed On The Suitable Farming System By Using Continuous Aluminium Profiled Section As Per Manufacturer With Suitable Size And Spacing To Withstand The Structural Design Criteria Specifled In The Technical Specification By Using Necessary Hdg Brackets, Ss316 Grade Anchor Bolts Etc As Per Manufacturer Specification. Cladding Joints Should Be With Open Groove System. With Prior Approval Of Concerned Superitending Engineer. 1317 Providing And Constructingnon Load Bearing Wall With 200 Mmgrinded Horizontally Perforated Clay Hollow Blockswithcompressive Strengthnotlessthan35kilogram / Sqcm, Uvalueof1.00W / M2k, Water Absorptionof15%Toleranceon Grindedbrickheightis+ / -1.00Mm, Masonrytobedoneusing Porothermdryflx.Systeamwith20mmthicksshapeapplication ( Applicationmethodneedtobe Followedasperwienerbergermethodology ) Blocksofsize 400Mmx200mmx200mm ( 12.5Brickper Square Metre. ) Including Cost Of Material, Labour Charges, Scaffolding, Curing At All Height, Complete As Per Specification & Directions Of Engineer In Charge. Cost Shall Be Inclusive Ofend Bricks To Be Used At Window Anddoorjambsforfixingholdfast.Anchorsetc., Plasteringistobedoneasperrequirement.Andistobe Considered Seperatly With Prior Approval Of Concerned Superitending Engineer. 1318 Providing And Constructingnon Load Bearing Wall With 150 Mm Grinded Horizontally Perforated Clay Hollow Blocks With Compressivestrength Not Less Than 35Kilogram / Sqcm, U Value Of 1.2 W / M2k, Water Absorption Of 15% Tolerance On Grinded Brick Height Is+ / - 1.00 Mm, Masonry To Be Done Usingdry Flx. Systeam With 20 Mm Thick S Shape Application ( Application Method Need To Be Followed As Per Wienerberger Methodology ) Blocks Of Size400mm X 150 Mm X 200 Mm ( 12.5 Brick Per Square Metre. ) Including Cost Of Material, Labour Charges, Scaffolding, Curing At All Height, Complete As Perspecification&Directions Ofengineer Incharge. Costshallbeinclusiveofendbrickstobeusedatwindowanddoorjambsforfixingholdfast.Anchors Etc., Plastering Is To Be Done As Per Requirement And Is To Be Considered Seperatly 1319 Providing And Constructingnon Load Bearing Wall With 100 Mm Grinded Horizontally Perforated Clay Hollow Blocks With Compressivestrength Not Less Than 35Kilogram / Sqcm, U Value Of 1.7 W / M2k, Water Absorption Of 15% Tolerance On Grinded Brick Height Is + / - 1.00 Mm, Masonry To Be Done Usingdry Flx. Systeam With 20 Mm Thick S Shape Application ( Application Method Need To Be Followed As Per Wienerberger Methodology ) Blocks Of Size400mm X 100 Mm X 200 Mm ( 12.5 Brick Per Square Metre. ) Including Cost Of Material, Labour Charges, Scaffolding, Curing At All Height, Rcc. Stiffener Band Necessary At Every 1.0 Meter Height Of The Wall, Complete As Per Specification & Directions Of Engineer In Charge. Cost Shall Be Inclusive Ofend Bricks To Be Used At Window And Door Jambs For Fixing Hold Fast. Anchors Etc., , Plastering Is To Be Done As Per Requirement, And Is To Be Considered Seperatly With Prior Approval Of Concerned Superitending Engineer. 1320 Providingandfixingofimportedclaytilespnm.S.Frameworkusing Maditerraneanplusrooftilesof Wienberger Tile Of Colour Red Engobe Or Equivalent With Necessary Accessories Required To Fix Tile Including Clips And Screw ( Prior Permission Of S.E. Is To Be Obtained Before Inclusion ) 1321 Providingandfixingductileironmanholecoveroflight / Medium / Heavydutywithframeofanysizeoverinspection Chamber Etc. Complete ( Prior Permission Of S.E. Is To Be Obtained Before Inclusion Of This Item In The Estimate ) 1322 Providing And Constructing Ductile Iron Circular Manhole 45 Cm Dia. At Top 90 Cm At Bottom Up To 1.80 Meter To2.70Meterdepthincludingexcavation, Laying1:4:8Cementconcretebedding15cmthickburntbrick Mansonry With 1:1 Cement Mortar Plaster 25 Mm Thick Inside And Outside 20 Mm ( 1:3 ) Ductile Iron Heavy Type Cover With Ring 125Kilogramin Weight. High Strength. More Life And Durability, Good Antiskid Grip, Suitable Toheavytheatricloading, Lightweightcastingaftercostbenefitsfortransportationrefillingetc.Asper Requirement. With Prior Approval Of Concerned Superitending Engineer. 1323 Providing Andlayingcemarkedwovenpolypropylenegeotextile Indigenouslymanufacturedfrom Black Uvstabilizedpolypropylene Tape Yarnoftechfabindiaonthepreparedsubgradeforreinforcementcum Separationcumdrainage&Filtrationapplicationwithnecessaryoverlapsasperdrawingetc.Complete. ( Specification: Morth Section-700 ) With Prior Approval Of Concerned Superitending Engineer. A ) Tfi-5300 Type-I 1324 Providing And Laying Ce Marked Woven Multifilament Polyester Geotextile Indigenously Manufactured Using Highmolecular Weight, Hightenacity Polyester Filament Yarnwith Hightensile Strength, Low Elongationand Lowcreepoftechfabindiaonthepreparedsubgradeforreinforcementcumseparationcumdrainage& Filtrationapplicationwithnecessary Overlapas Per Drawing Etc.Complete. ( Specification:Morthsection- 700 ) With Prior Approval Of Concerned Superitending Engineer. A ) Tfi-3100 1325 Providing And Laying Ce Marked Woven Multifilament Polyester Geotextile Indigenously Manufactured Using Highmolecular Weight, Hightenacity Polyester Filament Yarnwith Hightensile Strength, Low Elongationand Lowcreepoftechfabindiaonthepreparedsubgradeforreinforcementcumseparationcumdrainage& Filtrationapplicationwithnecessary Overlapas Per Drawing Etc.Complete. ( Specification:Morthsection- 700 ) With Prior Approval Of Concerned Superitending Engineer. B ) Tfi-3200 1326 Providingandlayingcemarkedneedlepunchedandmechanicallybondednon-Wovengeotextile ( Techgeo ) Indigenously Manufactured From High Quality Polypropylene Staple Fibres ( Continuous Filament Will Not Be Accepted ) Of Techfab India On The Prepared Subgrade For Separation, Drainage & Filtration Application Withnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Morthsection-700 ) Withpriorapproval Of Concerned Superitending Engineer. A ) Tfi Techgeo Pr-15 1327 Providingandlayingcemarkedneedlepunchedandmechanicallybondednon-Wovengeotextile ( Techgeo ) Indigenously Manufactured From High Quality Polypropylene Staple Fibres ( Continuous Filament Will Not Be Accepted ) Of Techfab India On The Prepared Subgrade For Separation, Drainage & Filtration Application Withnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Morthsection-700 ) Withpriorapproval Of Concerned Superitending Engineer. B ) Tfi Techgeo Pr-20 1328 Providingandlayingcemarkedneedlepunchedandmechanicallybondednon-Wovengeotextile ( Techgeo ) Indigenously Manufactured From High Quality Polypropylene Staple Fibres ( Continuous Filament Will Not Be Accepted ) Of Techfab India On The Prepared Subgrade For Separation, Drainage & Filtration Application Withnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Morthsection-700 ) Withpriorapproval Of Concerned Superitending Engineer. C ) Tfi Techgeo Pr-30 1329 Providingandlayingcemarkedneedlepunchedandmechanicallybondednon-Wovengeotextile ( Techgeo ) Indigenously Manufactured From High Quality Polypropylene Staple Fibres ( Continuous Filament Will Not Be Accepted ) Of Techfab India On The Prepared Subgrade For Separation, Drainage & Filtration Application Withnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Morthsection-700 ) Withpriorapproval Of Concerned Superitending Engineer. D ) Tfi Techgeo Pr-40 1330 Providingandlayingcemarkedneedlepunchedandmechanicallybondednon-Wovengeotextile ( Techgeo ) Indigenously Manufactured From High Quality Polypropylene Staple Fibres ( Continuous Filament Will Not Be Accepted ) Of Techfab India On The Prepared Subgrade For Separation, Drainage & Filtration Application Withnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Morthsection-700 ) Withpriorapproval Of Concerned Superitending Engineer. E ) Tfi Techgeo Pr-60 1331 Providing Andlaying Cemarkedknittedandpvccoatedpolyester Biaxial Geogrid ( Techgrid ) For Basal Reinforcementindigenouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecular Weight Of Techfab India ( > 25000 G / Mol ) , And Low Carboxyl End Group ( <30Mmol / Kilogram ) ( Extruded Pp Geogrids & Polyester Strips & Geostrips, Steel Strips Not Allowed ¬ Accepted ) . Requirement Of Geogrid Strength In Both Direction And Granular Fill. ( Coating Of Geogrid / Reinforcing Geosynthetic Material With Ldpe, Latex, Bitumenandanyothercoatingwillnotbeallowedandwillnotbeaccepted ) .Forreinforcement Applicationto Subgrade, Unboundsubbase / Base Courses & Soil Stabilization, Etc. Complete ( Specification: Morth Section-700 ) . With Prior Approval Of Concerned Superitending Engineer. A ) Tfi Techgrid Geogrid Tgb-40 1332 Providing Andlaying Cemarkedknittedandpvccoatedpolyester Biaxial Geogrid ( Techgrid ) For Basal Reinforcementindigenouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecular Weight Of Techfab India ( > 25000 G / Mol ) , And Low Carboxyl End Group ( <30Mmol / Kilogram ) ( Extruded Pp Geogrids & Polyester Strips & Geostrips, Steel Strips Not Allowed ¬ Accepted ) . Requirement Of Geogrid Strength In Both Direction And Granular Fill. ( Coating Of Geogrid / Reinforcing Geosynthetic Material With Ldpe, Latex, Bitumenandanyothercoatingwillnotbeallowedandwillnotbeaccepted ) .Forreinforcement Applicationto Subgrade, Unboundsubbase / Base Courses & Soil Stabilization, Etc. Complete ( Specification: Morth Section-700 ) . With Prior Approval Of Concerned Superitending Engineer. B ) Tfi Techgrid Geogrid Tgb-60 1333 Providingandlayingcemarkedppextrudedbiaxialgeogridforbasalreinforcement, Indigenously Manufactured From Virgin High Density Polypropylene Of Techfab India Having Aperture Size Of ( 38 X 38 ) Mm Andultimatetensilestrengthof20kn / Monbothdirectionwithminimumjunctionstrengthof95%& Minimum Radial Stiffness Of 350 Kn / M ( @0.5% Strain For Reinforcement Application To Subgrade, Unbound Sub Base / Basecourses&Soilstabilization, Etc.Complete ( Specification:Morthsection-700 ) .Withprior Approval Of Concerned Superitending Engineer. A ) Tfi Techgrid Geogrid Pp2020 1334 Providingandlayingcemarkedppextrudedbiaxialgeogridforbasalreinforcement, Indigenously Manufactured From Virgin High Density Polypropylene Of Techfab India Having Aperture Size Of ( 38 X 38 ) Mm Andultimatetensilestrengthof20kn / Monbothdirectionwithminimumjunctionstrengthof95%& Minimum Radial Stiffness Of 350 Kn / M ( @0.5% Strain For Reinforcement Application To Subgrade, Unbound Sub Base / Basecourses&Soilstabilization, Etc.Complete ( Specification:Morthsection-700 ) .Withprior Approval Of Concerned Superitending Engineer. B ) Tfi Techgrid Geogrid Pp3030 1335 Providing And Laying Ce Marked Knitted And Pvc Coated Polyester Uniaxial Geogrid ( Techgrid ) Indigenously Manufacturedfromselectedhightenacitypolyesteryarnwithhighmolecularweightoftechfabindia ( > 25000 G / Mol ) , And Low Carboxyl End Group ( <30 Mm Mol / Kilogram ) ( Extruded Pp Geogrid & Polyesterstrip & Geostrip, Steel Strips Not Allowed & Not Accepted ) With Granular Fill As Per Designprepared By Technical Provider Of Reinforced Earth Wall And Slope. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material With Ldpe, Latex, Bitumen And Any Other Coating Will Not Be Allowed And Will Not Be Accepted ) For Reinforced Soil Wall And Reinforced Slope Application, Etc. Complete ( Specification: Morth Section- 3100 ) .With Prior Approval Of Concerned Superitending Engineer. A ) Tfi Techgrid Geogrid Tgu-40 1336 Providing And Laying Ce Marked Knitted And Pvc Coated Polyester Uniaxial Geogrid ( Techgrid ) Indigenously Manufacturedfromselectedhightenacitypolyesteryarnwithhighmolecularweightoftechfabindia ( > 25000 G / Mol ) , And Low Carboxyl End Group ( <30 Mm Mol / Kilogram ) ( Extruded Pp Geogrid & Polyesterstrip & Geostrip, Steel Strips Not Allowed & Not Accepted ) With Granular Fill As Per Designprepared By Technical Provider Of Reinforced Earth Wall And Slope. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material With Ldpe, Latex, Bitumen And Any Other Coating Will Not Be Allowed And Will Not Be Accepted ) For Reinforced Soil Wall And Reinforced Slope Application, Etc. Complete ( Specification: Morth Section- 3100 ) .With Prior Approval Of Concerned Superitending Engineer. B ) Tfi Techgrid Geogrid Tgu-60 1337 Providing And Laying Geocell-Techcell Ce Marked A Three Dimensional Honeycomb Like Cellular Confinement System Having Weld Spacing 356Mm And Cell Depth 150Mm Of Techfab India, Indigenously Manufactured By Blend Of Various Polyethylene And Additives, Polyethylene Strips Ultrasonically Welded Consists Of A Multiple Rhomboidalindentationsovertheentirestriponthepreparedsubgradeforsubgradestabilizationby Reinforcement And Drainage Application For Roads, Ground Improvement Work And Erosion Control Of Slopes Etc. Complete. ( Specification: Morth Section-700 ) With Prior Approval Of Concerned Superitending Engineer. A ) Tfi Techcell Geocell-356X150 1338 Providing And Laying Geocell-Techcell Ce Marked A Three Dimensional Honeycomb Like Cellular Confinement System Having Weld Spacing 356Mm And Cell Depth 150Mm Of Techfab India, Indigenously Manufactured By Blend Of Various Polyethylene And Additives, Polyethylene Strips Ultrasonically Welded Consists Of A Multiple Rhomboidalindentationsovertheentirestriponthepreparedsubgradeforsubgradestabilizationby Reinforcement And Drainage Application For Roads, Ground Improvement Work And Erosion Control Of Slopes Etc. Complete. ( Specification: Morth Section-700 ) With Prior Approval Of Concerned Superitending Engineer. B ) Tfi Techcell Geocell-660X75 1339 Providingandlayingcemarkedreinforcednon-Wovencompositeindigenouslymanufacturedneedle Punched Polypropylene ( Continuous Filament Will Not Be Accepted ) Of Techfab India, Reinforced Withhigh Tenacitypolyesteryarn Onthepreparedsubgradeforreinforcementcumseparationcumdrainage& Filtrationapplicationwithnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Irc:Sp:59- Morth Section-700 ) With Prior Approval Of Concerned Superitending Engineer. A ) Tfi Tgc-60 1340 Providingandlayingcemarkedreinforcednon-Wovencompositeindigenouslymanufacturedneedle Punched Polypropylene ( Continuous Filament Will Not Be Accepted ) Of Techfab India, Reinforced Withhigh Tenacitypolyesteryarn Onthepreparedsubgradeforreinforcementcumseparationcumdrainage& Filtrationapplicationwithnecessaryoverlapsasperdrawingetc.Complete. ( Specification:Irc:Sp:59- Morth Section-700 ) With Prior Approval Of Concerned Superitending Engineer. B ) Tfi Tgc-90 1341 Providing And Inserting Ce Marked Prefabricated Vertical Drain / Band Drain ( Techdrain ) Of Techfab India Indigenously Manufactured With Polypropylene Core And Wrapped With Non-Woven Geotextile In The Very Soft Clay To A Design Depth For Quick Consolidation Etc. Complete. ( Specification: Morth Section-700 ) .With Prior Approval Of Concerned Superitending Engineer. A ) Tfi Techdrain Td-3520 U 100Mm X 4Mm 1342 Providing And Inserting Ce Marked Prefabricated Vertical Drain / Band Drain ( Techdrain ) Of Techfab India Indigenously Manufactured With Polypropylene Core And Wrapped With Non-Woven Geotextile In The Very Soft Clay To A Design Depth For Quick Consolidation Etc. Complete. ( Specification: Morth Section-700 ) .With Prior Approval Of Concerned Superitending Engineer. B ) Tfi Techdrain Td-5020 U 100Mm X 5Mm 1343 Providing & Fixing Ce Marked Metal Gabions Indigenously Manufactured As Per Required Section Including Boxesmade Ofmechanicallywovenhexagonalshapedwire Meshoftype, ( 8X10 ) Cm, Edgesmechanically Selvedgedmadeofheavily ( Zinc+Pvc ) Coatedg.I.Wiresasperbs:443, Meshwire2.70 / 3.70Mmø ( Id / Od ) , Edge Wire 3.40 / 4.40 Mm Ø ( Id / Od ) Of Techfab India Type And Filled With 20 To 50Kilogramweight Trap Stones Including Conveying With All Leads And Lifts And Placing At Required Places In Required Line, Level, Slope, Section As Directed, Etc. And Tied By 5% Lacing Wire 2.20 / 3.20 Mm Ø ( Id / Od ) As Directed By Engineer- In-Charge. For Retaining Walls, Toe Walls, Etc. For Slope Protection & Erosion Control Application Of River Bank & Sea-Shore Etc. Complete ( Specification: Morth Section-2500. ( Excluding Rubble ) With Prior Approval Of Concerned Superitending Engineer. A ) For 1M Height 1344 Providing & Fixing Ce Marked Metal Gabions Indigenously Manufactured As Per Required Section Including Boxesmade Ofmechanicallywovenhexagonalshapedwire Meshoftype, ( 8X10 ) Cm, Edgesmechanically Selvedgedmadeofheavily ( Zinc+Pvc ) Coatedg.I.Wiresasperbs:443, Meshwire2.70 / 3.70Mmø ( Id / Od ) , Edge Wire 3.40 / 4.40 Mm Ø ( Id / Od ) Of Techfab India Type And Filled With 20 To 50Kilogramweight Trap Stones Including Conveying With All Leads And Lifts And Placing At Required Places In Required Line, Level, Slope, Section As Directed, Etc. And Tied By 5% Lacing Wire 2.20 / 3.20 Mm Ø ( Id / Od ) As Directed By Engineer- In-Charge. For Retaining Walls, Toe Walls, Etc. For Slope Protection & Erosion Control Application Of River Bank & Sea-Shore Etc. Complete ( Specification: Morth Section-2500. ( Excluding Rubble ) With Prior Approval Of Concerned Superitending Engineer. B ) For 0.5M Height 1345 Providingandlaying Cemarkedglassfibregeocomposite ( Techglassaic ) Indigenouslymanufactured From High Performance Glass Fibre Roving To Form A Reticular Structural Material With A Unique Combination Of Fusedfibreglassandpolypropylenenon-Wovenneedlepunchedgeotextiletoasphaltoverlayflexible Pavementsandasphaltoverlaydistressedrigidpavementsoftechfabindiaforreinforcement, Seizure Reflective Cracks, Reduced Surface Rutting & Water Infiltration. ( Specification: Morth Section-700 ) .With Prior Approval Of Concerned Superitending Engineer. A ) Tfi Techglass Aic-50 1346 Providingandlaying Cemarkedglassfibregeocomposite ( Techglassaic ) Indigenouslymanufactured From High Performance Glass Fibre Roving To Form A Reticular Structural Material With A Unique Combination Of Fusedfibreglassandpolypropylenenon-Wovenneedlepunchedgeotextiletoasphaltoverlayflexible Pavementsandasphaltoverlaydistressedrigidpavementsoftechfabindiaforreinforcement, Seizure Reflective Cracks, Reduced Surface Rutting & Water Infiltration. ( Specification: Morth Section-700 ) .With Prior Approval Of Concerned Superitending Engineer. B ) Tfi Techglass Aic-100 1347 Providing Andlaying A Paving Fabric Cemarkedneedle Punchedandmechanically Bondednon-Woven Geotextileoftechfabindia, Indigenouslymanufacturedfromhighqualitypolypropylenestaplefibres ( Continuousfilamentwillnotbeaccepted ) Withheattreatmentononesidetoformastrong, Flexibleand Dimentionaly Stable Fabric Structure, With Optimum Bitumen Retention Capacity To Asphalt Overlay Over Flexible Pavementanddistressesregidpccpavementformoisturebarrier, Avoidrefelectivecrackingandstress Relieving Membrane With Necessary Overlaps As Per Drawing, Etc. Complete. ( Specification: Morth Section- 700 ) . With Prior Approval Of Concerned Superitending Engineer.A ) Tfi Techpave-C040 1348 Providingandlayingfindrains ( Drainagecomposite ) Tfitdc-55130Wcemarkedindigenously Manufacturedbythermobonding Apolypropylene Drainage Core-Geonetcomprisesoftwosetsofparallel Overlaidribsintegrallyconnectedtohavearhomboidalshapeandneedlepunched&Thermallybonded Nonwoven Geotextile On The Prepared Sub Base Of Paved / Unpaved Roads & Behind The Re Wall By Replacing Granular Filter Media For Separation, Drainage & Filtration Application With Necessary Overlaps As Per Drawing Etc.Complete. ( Specification:Morthsection-700 ) Withpriorapprovalofconcernedsuperitending Engineer.A ) Tfi Tdc-55130W 1349 Construction Of Reinforced Earth Wall In M-35 Block Facia By Providing And Laying Ce Marked Knitted And Pvccoatedpolyesteruniaxialgeogrid ( Techgrid ) Oftechfabindiaindegeniouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecularweight ( >25000G / Mol ) , Andlowcarboxylend Group ( <30Mmol / Kilogram ) For Reinforced Soil Wall ( Extruded Pp Geogrids & Polyester Strips &Geostrips, Steel Strips Not Allowed & Not Accepted ) With Granular Fill Of Phi-32 Degree ( Design Is To Be Carried Out In Accordance With Bs-8006 / Fhwa ) With Concrete Block By M-35 As Facia, Casting & Erection Of Blocks With Techgrid, Providing & Laying Levelling Pad By M-15, Providing And Laying Coping Beam By M-35, Providing And Laying 300Mm Thick Filtermedia Etc. Completed As Per Necessary Drawing And Instruction Of Engineer-In- Charge.Excludingproviding, Layingandcompactingselectedbackfillandretainedfillbehindthewall, Excavation And Ground Improvement, If Any. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material Withldpe, Latex, Bitumenandany Other Coating Will Notbe Allowedandwillnot Be Accepted ) . A ) Re Wall Height 1 To 4 Meter 1350 Construction Of Reinforced Earth Wall In M-35 Block Facia By Providing And Laying Ce Marked Knitted And Pvccoatedpolyesteruniaxialgeogrid ( Techgrid ) Oftechfabindiaindegeniouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecularweight ( >25000G / Mol ) , Andlowcarboxylend Group ( <30Mmol / Kilogram ) For Reinforced Soil Wall ( Extruded Pp Geogrids & Polyester Strips &Geostrips, Steel Strips Not Allowed & Not Accepted ) With Granular Fill Of Phi-32 Degree ( Design Is To Be Carried Out In Accordance With Bs-8006 / Fhwa ) With Concrete Block By M-35 As Facia, Casting & Erection Of Blocks With Techgrid, Providing & Laying Levelling Pad By M-15, Providing And Laying Coping Beam By M-35, Providing And Laying 300Mm Thick Filtermedia Etc. Completed As Per Necessary Drawing And Instruction Of Engineer-In- Charge.Excludingproviding, Layingandcompactingselectedbackfillandretainedfillbehindthewall, Excavation And Ground Improvement, If Any. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material Withldpe, Latex, Bitumenandany Other Coating Will Notbe Allowedandwillnot Be Accepted ) . B ) Re Wall Height 4 To 6 Meter 1351 Construction Of Reinforced Earth Wall In M-35 Block Facia By Providing And Laying Ce Marked Knitted And Pvccoatedpolyesteruniaxialgeogrid ( Techgrid ) Oftechfabindiaindegeniouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecularweight ( >25000G / Mol ) , Andlowcarboxylend Group ( <30Mmol / Kilogram ) For Reinforced Soil Wall ( Extruded Pp Geogrids & Polyester Strips &Geostrips, Steel Strips Not Allowed & Not Accepted ) With Granular Fill Of Phi-32 Degree ( Design Is To Be Carried Out In Accordance With Bs-8006 / Fhwa ) With Concrete Block By M-35 As Facia, Casting & Erection Of Blocks With Techgrid, Providing & Laying Levelling Pad By M-15, Providing And Laying Coping Beam By M-35, Providing And Laying 300Mm Thick Filtermedia Etc. Completed As Per Necessary Drawing And Instruction Of Engineer-In- Charge.Excludingproviding, Layingandcompactingselectedbackfillandretainedfillbehindthewall, Excavation And Ground Improvement, If Any. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material Withldpe, Latex, Bitumenandany Other Coating Will Notbe Allowedandwillnot Be Accepted ) . C ) Re Wall Height 6 To 8 Meter 1352 Construction Of Reinforced Earth Wall In M-35 Block Facia By Providing And Laying Ce Marked Knitted And Pvccoatedpolyesteruniaxialgeogrid ( Techgrid ) Oftechfabindiaindegeniouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecularweight ( >25000G / Mol ) , Andlowcarboxylend Group ( <30Mmol / Kilogram ) For Reinforced Soil Wall ( Extruded Pp Geogrids & Polyester Strips &Geostrips, Steel Strips Not Allowed & Not Accepted ) With Granular Fill Of Phi-32 Degree ( Design Is To Be Carried Out In Accordance With Bs-8006 / Fhwa ) With Concrete Block By M-35 As Facia, Casting & Erection Of Blocks With Techgrid, Providing & Laying Levelling Pad By M-15, Providing And Laying Coping Beam By M-35, Providing And Laying 300Mm Thick Filtermedia Etc. Completed As Per Necessary Drawing And Instruction Of Engineer-In- Charge.Excludingproviding, Layingandcompactingselectedbackfillandretainedfillbehindthewall, Excavation And Ground Improvement, If Any. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material Withldpe, Latex, Bitumenandany Other Coating Will Notbe Allowedandwillnot Be Accepted ) . D ) Re Wall Height 8 To 10 Meter 1353 Construction Of Reinforced Earth Wall In M-35 Block Facia By Providing And Laying Ce Marked Knitted And Pvccoatedpolyesteruniaxialgeogrid ( Techgrid ) Oftechfabindiaindegeniouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecularweight ( >25000G / Mol ) , Andlowcarboxylend Group ( <30Mmol / Kilogram ) For Reinforced Soil Wall ( Extruded Pp Geogrids & Polyester Strips &Geostrips, Steel Strips Not Allowed & Not Accepted ) With Granular Fill Of Phi-32 Degree ( Design Is To Be Carried Out In Accordance With Bs-8006 / Fhwa ) With Concrete Block By M-35 As Facia, Casting & Erection Of Blocks With Techgrid, Providing & Laying Levelling Pad By M-15, Providing And Laying Coping Beam By M-35, Providing And Laying 300Mm Thick Filtermedia Etc. Completed As Per Necessary Drawing And Instruction Of Engineer-In- Charge.Excludingproviding, Layingandcompactingselectedbackfillandretainedfillbehindthewall, Excavation And Ground Improvement, If Any. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material Withldpe, Latex, Bitumenandany Other Coating Will Notbe Allowedandwillnot Be Accepted ) .E ) Re Wall Height 10 To 12 Meter 1354 Construction Of Reinforced Earth Wall In M-35 Block Facia By Providing And Laying Ce Marked Knitted And Pvccoatedpolyesteruniaxialgeogrid ( Techgrid ) Oftechfabindiaindegeniouslymanufactured From Selectedhightenacitypolyesteryarnwithhighmolecularweight ( >25000G / Mol ) , Andlowcarboxylend Group ( <30Mmol / Kilogram ) For Reinforced Soil Wall ( Extruded Pp Geogrids & Polyester Strips &Geostrips, Steel Strips Not Allowed & Not Accepted ) With Granular Fill Of Phi-32 Degree ( Design Is To Be Carried Out In Accordance With Bs-8006 / Fhwa ) With Concrete Block By M-35 As Facia, Casting & Erection Of Blocks With Techgrid, Providing & Laying Levelling Pad By M-15, Providing And Laying Coping Beam By M-35, Providing And Laying 300Mm Thick Filtermedia Etc. Completed As Per Necessary Drawing And Instruction Of Engineer-In- Charge.Excludingproviding, Layingandcompactingselectedbackfillandretainedfillbehindthewall, Excavation And Ground Improvement, If Any. The Reinforced Earth Wall And Slope Should Have 100% Coverage Of5mwidthknittedandpvccoatedpolyestergeogrid. ( Coatingofgeogrid / Reinforcinggeosynthetic Material Withldpe, Latex, Bitumenandany Other Coating Will Notbe Allowedandwillnot Be Accepted ) .F ) Re Wall Height 12 To 14 Meter 1355 Providing Heavy Duty Fibre Glass Reinforced Plastic Temporary Barricade Of 1.75 M Hight, With Base Width Of 430 Mm As A Provision To Accept Water Ballasting Of 101 Itrs-110 Ltrs Approx. And Arrangement For Traffic Diversionsuchastraffic Signalsduring Constructionat Site, For Dayandnightas Perrequirement. The Raw Material Shall Be Uv Stabilized Linear Low Density Polyethylene And Should Meet Therequirements Stipulated In Standard Is: 10146-1982, Is:10141-1982And Should Also Comply To Fda:Cfr Title 21.177.1520. Olefin Polymers , With Specific Frp Grade 300-104 Reinforced During Moulding Process To The Permissible Extent For Improved Impact Strength. Qualification Criteria: For Qualifying Thesample , Few Tests Shall Be Performed At Government Lab Or Nabl Accredited Lab On Site Safety Fence Sample, Failure Or Deviations In Test Results Of Sampleshall Be Disqualified.The Tests And Qualifying Results Are As Under, ( A ) Tensile Strength At Yield By Astmd638=20.93Mpa, ( B ) Elongationatbreakastmd638=121.66Mpa ( C ) Flexuralmodulus Astm D 790 = 633.76 Mpa ( D ) Izod Impact Strenth ( Notched ) Astm D 256 = 4.41Kilogram / Square Metre ( E ) Izod Impact Strenth ( Un-Notched ) Astm D 256 = 67.04Kilogram / Square Metre ( F ) Drop Impact Strength 25Kilogramloadfrom 1M, 2M &5M Height Theweightofemptysinglerotomouldedplasticbarricade Withoutwaterballastingshallbe34kilogramsapprox.&Totalweightafterwaterallastingshallbe135 Kilograms -140 Kilograms + / - 5 Kilograms ( Tolarance ) The Main Barricade Body Of Hight 1750 Mm Approx Is Connected With The Extension Body Through 4 Set Of Nut Bolt Washers .Extenstion Body Through 4 Set Of Nut Boltwashers. Extension Body Is Designed With 9 Nos Kiss Offs On Rear Side; The Dimension Of Extension Body Are 1500 Mm ( Length ) , 70 Mm ( Width ) , 250 Mm ( Effetive Height After Fixing ) & Dimension Of Its Male Collarare 1420 Mm ( Length ) , 25 Mm ( Width ) , 30 Mm Approx ( Height ) , It Is Inserted In U Groove Provisionedon Top Of Mainbodybarricademodelforinterlconnecting.Theminimumthicknessofalloversurfaceofplastic Barricaed Shall Be 5 Mm + / - 20%.The Rear Bottam Shall Have To Provision To Fix Two Brackets At Both Endin Cornerforanchoringpurpose.Eachrearbracketisconstructedthroughrodofdia.60Mmwithcurvature Welded Withms Strip Of 3 Mm Thick , 50 Mm Width And 90Mm Length At Its Top And Base , Effective Bracket Shall Be 410 Mm Approx. The Anchoring Hole In Each Bracket Shall Be 18 Mm Dia. For Routine The Ms Bolts Of 16 Mm Thickness And 150 Mm Length With Sharp Pointed Edge At One End.The Upper Part Of Each Bracket Shall Haveaslotsizeof30mm X10mmforconnectingit Withbarracademodelthroughbolts.Similarlyfront Bracket For Site Safety Fence Is 3Mm Thick , 50Mm Width, Feective Height After Single Bendis 230Mm And Anchoringineachbracketshallbedia18mmuniquesafetyfeatureforfirmgrippingtopreventfrom Displacement And Fallingwhen Inter Connected Even Without Water Filling . There Shall Be 7 NoS Premoulded A ) For725 Mmheight ( Ltypejerseybarrier ) , Emptyweight:6.67 Kilogram / Rgm, Weightfull:35.89Kilogram / Rgm Approx. ( After Water / Sand Filling ) 1356 Providing Heavy Duty Fibre Glass Reinforced Plastic Temporary Barricade Of 1.75 M Hight, With Base Width Of 430 Mm As A Provision To Accept Water Ballasting Of 101 Itrs-110 Ltrs Approx. And Arrangement For Traffic Diversionsuchastraffic Signalsduring Constructionat Site, For Dayandnightas Perrequirement. The Raw Material Shall Be Uv Stabilized Linear Low Density Polyethylene And Should Meet Therequirements Stipulated In Standard Is: 10146-1982, Is:10141-1982And Should Also Comply To Fda:Cfr Title 21.177.1520. Olefin Polymers , With Specific Frp Grade 300-104 Reinforced During Moulding Process To The Permissible Extent For Improved Impact Strength. Qualification Criteria: For Qualifying Thesample , Few Tests Shall Be Performed At Government Lab Or Nabl Accredited Lab On Site Safety Fence Sample, Failure Or Deviations In Test Results Of Sampleshall Be Disqualified.The Tests And Qualifying Results Are As Under, ( A ) Tensile Strength At Yield By Astmd638=20.93Mpa, ( B ) Elongationatbreakastmd638=121.66Mpa ( C ) Flexuralmodulus Astm D 790 = 633.76 Mpa ( D ) Izod Impact Strenth ( Notched ) Astm D 256 = 4.41Kilogram / Square Metre ( E ) Izod Impact Strenth ( Un-Notched ) Astm D 256 = 67.04Kilogram / Square Metre ( F ) Drop Impact Strength 25Kilogramloadfrom 1M, 2M &5M Height Theweightofemptysinglerotomouldedplasticbarricade Withoutwaterballastingshallbe34kilogramsapprox.&Totalweightafterwaterallastingshallbe135 Kilograms -140 Kilograms + / - 5 Kilograms ( Tolarance ) The Main Barricade Body Of Hight 1750 Mm Approx Is Connected With The Extension Body Through 4 Set Of Nut Bolt Washers .Extenstion Body Through 4 Set Of Nut Boltwashers. Extension Body Is Designed With 9 Nos Kiss Offs On Rear Side; The Dimension Of Extension Body Are 1500 Mm ( Length ) , 70 Mm ( Width ) , 250 Mm ( Effetive Height After Fixing ) & Dimension Of Its Male Collarare 1420 Mm ( Length ) , 25 Mm ( Width ) , 30 Mm Approx ( Height ) , It Is Inserted In U Groove Provisionedon Top Of Mainbodybarricademodelforinterlconnecting.Theminimumthicknessofalloversurfaceofplastic Barricaed Shall Be 5 Mm + / - 20%.The Rear Bottam Shall Have To Provision To Fix Two Brackets At Both Endin Cornerforanchoringpurpose.Eachrearbracketisconstructedthroughrodofdia.60Mmwithcurvature Welded Withms Strip Of 3 Mm Thick , 50 Mm Width And 90Mm Length At Its Top And Base , Effective Bracket Shall Be 410 Mm Approx. The Anchoring Hole In Each Bracket Shall Be 18 Mm Dia. For Routine The Ms Bolts Of 16 Mm Thickness And 150 Mm Length With Sharp Pointed Edge At One End.The Upper Part Of Each Bracket Shall Haveaslotsizeof30mm X10mmforconnectingit Withbarracademodelthroughbolts.Similarlyfront Bracket For Site Safety Fence Is 3Mm Thick , 50Mm Width, Feective Height After Single Bendis 230Mm And Anchoringineachbracketshallbedia18mmuniquesafetyfeatureforfirmgrippingtopreventfrom Displacement And Fallingwhen Inter Connected Even Without Water Filling . There Shall Be 7 NoS Premoulded B ) For750mmheight ( Withinterlockingprovison-Fortrafficdelineationapplications ) , Empty Weight:9.04 Kilogram / Rgm, Weight Full : 57.14Kilogram / Rgm Approx. ( After Water / Sand Filling ) 1357 Providing Heavy Duty Fibre Glass Reinforced Plastic Temporary Barricade Of 1.75 M Hight, With Base Width Of 430 Mm As A Provision To Accept Water Ballasting Of 101 Itrs-110 Ltrs Approx. And Arrangement For Traffic Diversionsuchastraffic Signalsduring Constructionat Site, For Dayandnightas Perrequirement. The Raw Material Shall Be Uv Stabilized Linear Low Density Polyethylene And Should Meet Therequirements Stipulated In Standard Is: 10146-1982, Is:10141-1982And Should Also Comply To Fda:Cfr Title 21.177.1520. Olefin Polymers , With Specific Frp Grade 300-104 Reinforced During Moulding Process To The Permissible Extent For Improved Impact Strength. Qualification Criteria: For Qualifying Thesample , Few Tests Shall Be Performed At Government Lab Or Nabl Accredited Lab On Site Safety Fence Sample, Failure Or Deviations In Test Results Of Sampleshall Be Disqualified.The Tests And Qualifying Results Are As Under, ( A ) Tensile Strength At Yield By Astmd638=20.93Mpa, ( B ) Elongationatbreakastmd638=121.66Mpa ( C ) Flexuralmodulus Astm D 790 = 633.76 Mpa ( D ) Izod Impact Strenth ( Notched ) Astm D 256 = 4.41Kilogram / Square Metre ( E ) Izod Impact Strenth ( Un-Notched ) Astm D 256 = 67.04Kilogram / Square Metre ( F ) Drop Impact Strength 25Kilogramloadfrom 1M, 2M &5M Height Theweightofemptysinglerotomouldedplasticbarricade Withoutwaterballastingshallbe34kilogramsapprox.&Totalweightafterwaterallastingshallbe135 Kilograms -140 Kilograms + / - 5 Kilograms ( Tolarance ) The Main Barricade Body Of Hight 1750 Mm Approx Is Connected With The Extension Body Through 4 Set Of Nut Bolt Washers .Extenstion Body Through 4 Set Of Nut Boltwashers. Extension Body Is Designed With 9 Nos Kiss Offs On Rear Side; The Dimension Of Extension Body Are 1500 Mm ( Length ) , 70 Mm ( Width ) , 250 Mm ( Effetive Height After Fixing ) & Dimension Of Its Male Collarare 1420 Mm ( Length ) , 25 Mm ( Width ) , 30 Mm Approx ( Height ) , It Is Inserted In U Groove Provisionedon Top Of Mainbodybarricademodelforinterlconnecting.Theminimumthicknessofalloversurfaceofplastic Barricaed Shall Be 5 Mm + / - 20%.The Rear Bottam Shall Have To Provision To Fix Two Brackets At Both Endin Cornerforanchoringpurpose.Eachrearbracketisconstructedthroughrodofdia.60Mmwithcurvature Welded Withms Strip Of 3 Mm Thick , 50 Mm Width And 90Mm Length At Its Top And Base , Effective Bracket Shall Be 410 Mm Approx. The Anchoring Hole In Each Bracket Shall Be 18 Mm Dia. For Routine The Ms Bolts Of 16 Mm Thickness And 150 Mm Length With Sharp Pointed Edge At One End.The Upper Part Of Each Bracket Shall Haveaslotsizeof30mm X10mmforconnectingit Withbarracademodelthroughbolts.Similarlyfront Bracket For Site Safety Fence Is 3Mm Thick , 50Mm Width, Feective Height After Single Bendis 230Mm And Anchoringineachbracketshallbedia18mmuniquesafetyfeatureforfirmgrippingtopreventfrom Displacement And Fallingwhen Inter Connected Even Without Water Filling . There Shall Be 7 NoS Premoulded C ) For750mmheight ( Jerseybarriermodelwithuniqueinterlockingprovision ) , Emptyweight:9.0Kilogram / Rgm Weight Full : 55 00Kilogram / Rgm Approx ( After Water / Sand Filling ) 1358 Providing Heavy Duty Fibre Glass Reinforced Plastic Temporary Barricade Of 1.75 M Hight, With Base Width Of 430 Mm As A Provision To Accept Water Ballasting Of 101 Itrs-110 Ltrs Approx. And Arrangement For Traffic Diversionsuchastraffic Signalsduring Constructionat Site, For Dayandnightas Perrequirement. The Raw Material Shall Be Uv Stabilized Linear Low Density Polyethylene And Should Meet Therequirements Stipulated In Standard Is: 10146-1982, Is:10141-1982And Should Also Comply To Fda:Cfr Title 21.177.1520. Olefin Polymers , With Specific Frp Grade 300-104 Reinforced During Moulding Process To The Permissible Extent For Improved Impact Strength. Qualification Criteria: For Qualifying Thesample , Few Tests Shall Be Performed At Government Lab Or Nabl Accredited Lab On Site Safety Fence Sample, Failure Or Deviations In Test Results Of Sampleshall Be Disqualified.The Tests And Qualifying Results Are As Under, ( A ) Tensile Strength At Yield By Astmd638=20.93Mpa, ( B ) Elongationatbreakastmd638=121.66Mpa ( C ) Flexuralmodulus Astm D 790 = 633.76 Mpa ( D ) Izod Impact Strenth ( Notched ) Astm D 256 = 4.41Kilogram / Square Metre ( E ) Izod Impact Strenth ( Un-Notched ) Astm D 256 = 67.04Kilogram / Square Metre ( F ) Drop Impact Strength 25Kilogramloadfrom 1M, 2M &5M Height Theweightofemptysinglerotomouldedplasticbarricade Withoutwaterballastingshallbe34kilogramsapprox.&Totalweightafterwaterallastingshallbe135 Kilograms -140 Kilograms + / - 5 Kilograms ( Tolarance ) The Main Barricade Body Of Hight 1750 Mm Approx Is Connected With The Extension Body Through 4 Set Of Nut Bolt Washers .Extenstion Body Through 4 Set Of Nut Boltwashers. Extension Body Is Designed With 9 Nos Kiss Offs On Rear Side; The Dimension Of Extension Body Are 1500 Mm ( Length ) , 70 Mm ( Width ) , 250 Mm ( Effetive Height After Fixing ) & Dimension Of Its Male Collarare 1420 Mm ( Length ) , 25 Mm ( Width ) , 30 Mm Approx ( Height ) , It Is Inserted In U Groove Provisionedon Top Of Mainbodybarricademodelforinterlconnecting.Theminimumthicknessofalloversurfaceofplastic Barricaed Shall Be 5 Mm + / - 20%.The Rear Bottam Shall Have To Provision To Fix Two Brackets At Both Endin Cornerforanchoringpurpose.Eachrearbracketisconstructedthroughrodofdia.60Mmwithcurvature Welded Withms Strip Of 3 Mm Thick , 50 Mm Width And 90Mm Length At Its Top And Base , Effective Bracket Shall Be 410 Mm Approx. The Anchoring Hole In Each Bracket Shall Be 18 Mm Dia. For Routine The Ms Bolts Of 16 Mm Thickness And 150 Mm Length With Sharp Pointed Edge At One End.The Upper Part Of Each Bracket Shall Haveaslotsizeof30mm X10mmforconnectingit Withbarracademodelthroughbolts.Similarlyfront Bracket For Site Safety Fence Is 3Mm Thick , 50Mm Width, Feective Height After Single Bendis 230Mm And Anchoringineachbracketshallbedia18mmuniquesafetyfeatureforfirmgrippingtopreventfrom Displacement And Fallingwhen Inter Connected Even Without Water Filling . There Shall Be 7 NoS Premoulded D ) Site Safety Fence ( 1.75 Mtrs ( H ) ) ( Efficient Substitution To Sheet Metal Barricade ) , Empty Weight 16.57: Kilogram / Rgm, Weight Full : 74.29 Kilogram / Rgm Approx. ( After Water / Sand Filling ) 1359 Providing Heavy Duty Fibre Glass Reinforced Plastic Temporary Barricade Of 1.75 M Hight, With Base Width Of 430 Mm As A Provision To Accept Water Ballasting Of 101 Itrs-110 Ltrs Approx. And Arrangement For Traffic Diversionsuchastraffic Signalsduring Constructionat Site, For Dayandnightas Perrequirement. The Raw Material Shall Be Uv Stabilized Linear Low Density Polyethylene And Should Meet Therequirements Stipulated In Standard Is: 10146-1982, Is:10141-1982And Should Also Comply To Fda:Cfr Title 21.177.1520. Olefin Polymers , With Specific Frp Grade 300-104 Reinforced During Moulding Process To The Permissible Extent For Improved Impact Strength. Qualification Criteria: For Qualifying Thesample , Few Tests Shall Be Performed At Government Lab Or Nabl Accredited Lab On Site Safety Fence Sample, Failure Or Deviations In Test Results Of Sampleshall Be Disqualified.The Tests And Qualifying Results Are As Under, ( A ) Tensile Strength At Yield By Astmd638=20.93Mpa, ( B ) Elongationatbreakastmd638=121.66Mpa ( C ) Flexuralmodulus Astm D 790 = 633.76 Mpa ( D ) Izod Impact Strenth ( Notched ) Astm D 256 = 4.41Kilogram / Square Metre ( E ) Izod Impact Strenth ( Un-Notched ) Astm D 256 = 67.04Kilogram / Square Metre ( F ) Drop Impact Strength 25Kilogramloadfrom 1M, 2M &5M Height Theweightofemptysinglerotomouldedplasticbarricade Withoutwaterballastingshallbe34kilogramsapprox.&Totalweightafterwaterallastingshallbe135 Kilograms -140 Kilograms + / - 5 Kilograms ( Tolarance ) The Main Barricade Body Of Hight 1750 Mm Approx Is Connected With The Extension Body Through 4 Set Of Nut Bolt Washers .Extenstion Body Through 4 Set Of Nut Boltwashers. Extension Body Is Designed With 9 Nos Kiss Offs On Rear Side; The Dimension Of Extension Body Are 1500 Mm ( Length ) , 70 Mm ( Width ) , 250 Mm ( Effetive Height After Fixing ) & Dimension Of Its Male Collarare 1420 Mm ( Length ) , 25 Mm ( Width ) , 30 Mm Approx ( Height ) , It Is Inserted In U Groove Provisionedon Top Of Mainbodybarricademodelforinterlconnecting.Theminimumthicknessofalloversurfaceofplastic Barricaed Shall Be 5 Mm + / - 20%.The Rear Bottam Shall Have To Provision To Fix Two Brackets At Both Endin Cornerforanchoringpurpose.Eachrearbracketisconstructedthroughrodofdia.60Mmwithcurvature Welded Withms Strip Of 3 Mm Thick , 50 Mm Width And 90Mm Length At Its Top And Base , Effective Bracket Shall Be 410 Mm Approx. The Anchoring Hole In Each Bracket Shall Be 18 Mm Dia. For Routine The Ms Bolts Of 16 Mm Thickness And 150 Mm Length With Sharp Pointed Edge At One End.The Upper Part Of Each Bracket Shall Haveaslotsizeof30mm X10mmforconnectingit Withbarracademodelthroughbolts.Similarlyfront Bracket For Site Safety Fence Is 3Mm Thick , 50Mm Width, Feective Height After Single Bendis 230Mm And Anchoringineachbracketshallbedia18mmuniquesafetyfeatureforfirmgrippingtopreventfrom Displacement And Fallingwhen Inter Connected Even Without Water Filling . There Shall Be 7 NoS Premoulded E ) Site Safety Fence ( 2.00 Mtrs ( H ) ) ( Efficient Substitution To Sheet Metal Barricade ) , Empty Weight : 17.00 Kilogram / Rgm, Weight Full : 70.00 Kilogram / Rgm Approx. ( After Water / Sand Filling ) 1360 Organosilance Nanotechnology For Bituminous Organosilance Nanotechnology Such As Zycotherm Added In The Bitumen Binder @ 0.1% Dosage To The Weight Of The Bitumen At Hma Plant To Schive Chemical Bonding, Completecoatingandconsistantcompactioninvariousbituminousmixessuchas Bm / Dbm / Carpet / Sealcoat / Mss / Sdbc Etc.As Per The Direction Of Engineer-In-Charge With Prior Approval Of Concerned Superitending Engineer. 1361 Waterproofingofsubgrade:Waterproofingontopcompacted ( Asperrelevantmort&Hspecification ) Sub Gradeandshouldersoilbasewithorganosilancenanotechonology&Nanoacrylicco-Polymerwithwater ( <1000Ppmtds ) Intheratioof1kilogramorganosilance Nanotechonology:1Kilogramnanoacrylicco- Polymer:200Literwaterspray@3Liter / Squaremetreintwosprayapplication ( 1.5Liter+1.5Liter ) Asper Direction Of The Engineer-In-Charge. With Prior Approval Of Concerned Superitending Engineer. 1362 Providing And Applying Primer Coat With Bitumen Emulsion On Prepared Surface Of Aggregate Layer Including Clearing Ofroadsurface Andspraying Primermixedwithnano-Technologysilance Inthe Ratio1:100:100 ( 1Kilogramsilance:100Kilogramss1emulsion:100Literwater ) ;Therateof1liter / Squaremetreusing Mechanical Means As Per The Direction Of Engineer-In-Charge. With Prior Approval Of Concerned Superitending Engineer. 1363 Tack Coat ( With Silance Nanotechnology ) :Preparing And Applying Of Water Soluable Organo Silance Nanotechnology ( Forbitumenemulsionapplication, Ircapproved ) Withcationicbitumenemulsioncrs1 Amd Water ( < 1000Ppm Tds ) In The Ratio Of 1:4Kilogram Organosilance : 100Kilogram Cationic Bitumen Emulsion Crss1: 200 Liter Water. With Prior Approval Of Concerned Superitending Engineer. 1364 Construction Of Stabilised Soil Base With Organo Silanceby Providing Locally Available Moorum / Soil ( 70% ) Mixed With 30% Gsb ? With 2% Cement By Mdd Of Mix, 0.6 Kilogram / Cum Nanotechnology Silane & 0.6Kilogram / Cum Of Acrilic Nano - Co Polymer, Spreading In Uniform Layers With Grader On Prepared Surface By Mixing In Place Method Withrotavator At Omc And Compacting With Smooth Wheel Roller To Achieve The Desired Density, Complete As Per Table 2.3 Of Irc Sp - 77-2008 As Per Direcion Of Engineer - In -Charge. With Prior Approval Of Concerned Superitending Engineer. 1365 Construction Of Stabilised Soil Base With Organo Silanceby Providing Locally Available Moorum / Soil ( 70% ) Mixed With 30% Gsb ? With 3% Cement By Mdd Of Mix, 0.6 Kilogram / Cum Nanotechnology Silane & 0.6 Kilogram / Cum Of Acrilic Nano - Co Polymer, Spreading In Uniform Layers With Grader On Prepared Surface Bymixing In Place Method Withrotavator At Omc And Compacting With Smooth Wheel Roller To Achieve The Desired Density, Complete As Per Table 2.3 Of Irc Sp - 77-2008 As Per Direcion Of Engineer - In -Charge.With Prior Approval Of Concerned Superitending Engineer. 1366 Construction Of Stabilised Soil Base With Organo Silanceby Providing Locally Available Moorum / Soil ( 70% ) Mixed With 30% Gsb ? With 4% Cement By Mdd Of Mix, 0.6 Kilogram / Cum Nanotechnology Silane & 0.6 Kilogram / Cum Of Acrilic Nano - Co Polymer, Spreading In Uniform Layers With Grader On Prepared Surface Bymixing In Place Method Withrotavator At Omc And Compacting With Smooth Wheel Roller To Achieve The Desired Density, Complete As Per Table 2.3 Of Irc Sp - 77-2008 As Per Direcion Of Engineer - In -Charge. 1367 Supplying Trap / Granite / Quartzite / Gneiss Stone Metal Of Required Size By Bringing The Boulders / Rubble At The Roadsidebreakingthemtorequiredgradationincludingconveyingtheboulders / Rubbleandstackingthe Broken Metal Etc. Complete . ( Prior Approval Of Sample Stack Of Broken Metal By The Ex. Engineer Is Necessary The Date Of Approval Will Form Part Of The Measurements ) A ) 80 Mm Metal, By Breaking Rubble Obtained By Blasting. ( Hand Broken ) . With Prior Approval Of Concerned Superitending Engineer. 1368 Supplying Trap / Granite / Quartzite / Gneiss Stone Metal Of Required Size By Bringing The Boulders / Rubble At The Roadsidebreakingthemtorequiredgradationincludingconveyingtheboulders / Rubbleandstackingthe Broken Metal Etc. Complete . ( Prior Approval Of Sample Stack Of Broken Metal By The Ex. Engineer Is Necessary The Date Of Approval Will Form Part Of The Measurements ) A ) 40 Mm Metal, By Breaking Rubblebtid B Bl Ti ( Hd B K ) 1369 Supplying Trap / Granite / Quartzite / Gneiss Stone Metal Of Required Size By Bringing The Boulders / Rubble At The Roadsidebreakingthemtorequiredgradationincludingconveyingtheboulders / Rubbleandstackingthe Broken Metal Etc. Complete . ( Prior Approval Of Sample Stack Of Broken Metal By The Ex. Engineer Is Necessary The Date Of Approval Will Form Part Of The Measurements ) A ) 80 Mm Metal, By Breaking Boulders ( Hand Broken ) 1370 Supplying Trap / Granite / Quartzite / Gneiss Stone Metal Of Required Size By Bringing The Boulders / Rubble At The Roadsidebreakingthemtorequiredgradationincludingconveyingtheboulders / Rubbleandstackingthe Broken Metal Etc. Complete . ( Prior Approval Of Sample Stack Of Broken Metal By The Ex. Engineer Is Necessary Thedateofapprovalwillformpartofthemeasurements ) A ) 40Mmmetal, Bybreakingboulders ( Hand Broken ) 1371 Spreading 80 / 40Mmmetalforroadworkincludingsectionongetccompleteasdirectedbyengineerincharge . 1372 Compacting The Sub Grade / Gravel / Oversize Metal ( 200 Mm Loose ) Layers For All Width With Power Roller Having Weight 8 To 10 Mt. Including Necessary, Labour, Materials And Artificial Watering Complete. 1373 Compactingthesubgrade / Gravel / Oversizemetal ( 200Mm Loose ) Layersforallwidthwithvibratoryroller Having Weight 8 To 10 Mt. Including Necessary, Labour, Materials And Artificial Watering Complete. 1374 Compacting The Sub Grade / Gravel / Size Metal ( 100 Mm Loose ) Layers For All Widths With Power Roller Having Weight 8 To 10 Mt. Including Necessary, Labour, Materials And Artificial Watering Complete. 1375 Compactingthesubgrade / Gravel / Sizemetal ( 100Mm Loose ) Layersforallwidthswithvibratoryroller Having Weight 8 To 10 Mt. Including Necessary, Labour, Materials And Artificial Watering Complete. 1376 Providingandapplyingtwocoatsapexultimapuranatureanti-Pollutionorequivalentapprovedbrand, Paint Should Decomposes Organic Substances And Inorganic Gases ( Nox, Voc‘S, Co, Sox, Formaldehydes, Etc. ) Inpresenceofnaturalorartificiallight.Itcontainsgrapheneandnanoparticlesof Titanium Oxide. And Absorbs Co2 ( 4.8 Kilogram / 15 L ) . Plaster Crack Should Be Filled By Acrylic Base Crack Seal / Textured Crack Filler, Paint Has To Applied On One Coat Of Apex Ultima Puranature Anti-Pollution Primer Or Equivalent. Warranty Should Be Given By The Manufaturer The Work Should Be Done By The Manufacturer Recommendedapplicatorandheshouldbeabletofurnishstagewiseonsitetechnicalreportsfromthe Concerned Company Technologist. 1377 Supply Of Ready Mix Patch Repairing Compound As Per Section 3000.2.2 ( Filling Pothole And Patches Repair With Specificapprovaloftheengineer ) , Mort&Hspecificationsforroadsandbridgeworks, 5Threvision, For Instant Repair Of Surface Defects Ofroad Under All Weather Conditions.The Premix Should Consists Of A Binder Withhydrophilicpropertiesandacceleratedadherence Toalltypesofaggregaresandcanbeappliedonall Patchesandpotholesincludingwaterloggedpatchesandpoyholesandinrainyconditions.Thematerial Should Be Suitable For Both Bituminous And Concrete Roads With Quick Setting Properties And Allow Traffic To Be Released Within 10 Mins.Of Patch Or Pothole Repair.The Material Should For Use On Roads With Both Passanger Andheavycommercialvechiles.The Mixshouldbe Suitable Forreparing Ofsurfacing Course Andshouldbe Comparisingoffineaggregates0-10Mm, ( 5.5-7.5% ) .Additivesasewquired.Themixshouldpackedinbags Which Can Be Easily Handled Manually And Be Storable Under Normal Storage Conditions For At Least 8 Month. 1378 Firedoor45mm1hrfrl ( 60 / 60 ) 3Criteria-Integrity / Insulation / Stabilitywoodendoor - Fire Door Tested In Accordance To Is: 3614 Part 2. Providing60 Min Fire Rated Doors System Duly Tested For 3 Criteria - Integrity, Insulation And Stability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 At National Test House, Govt Of India Laborator And / Or With Central Building Research Institute, Govt Of India Undertaking With Standard Heating Conditions As Specified Inis:3614Partii1992andbs:476Part20&221987Toachievetherequiredintegrity, Insulationand Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise Onthe Nonfire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Non Combustible By Nature ) . With Prior Approval Of Concerned Superitending Engineer. A ) Doorframe:Supplying Framesforfireresistantdoorshutters1stclassmalaysianhardwoodframe Densified ( 810Kilogram / Cum ) Andpressuretreatedwithfireretardantchemicalsinvacuumimpregnation Vessel Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Of Section 120 X 60 Mm Spray Quoted With 2 Coats Of Intumescent Paint Of Minimum 200 Micron, With Single Row Of Brush- Type Astroflame Intumescent Strip Of Size 10Mm X 4Mm Affixed In The Slit Of The Frame For Fire And Smoke Sealing, Etc. Complete. 1379 Firedoor45mm1hrfrl ( 60 / 60 ) 3Criteria-Integrity / Insulation / Stabilitywoodendoor - Fire Door Tested In Accordance To Is: 3614 Part 2. Providing60 Min Fire Rated Doors System Duly Tested For 3 Criteria - Integrity, Insulation And Stability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 At National Test House, Govt Of India Laborator And / Or With Central Building Research Institute, Govt Of India Undertaking With Standard Heating Conditions As Specified Inis:3614Partii1992andbs:476Part20&221987Toachievetherequiredintegrity, Insulationand Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise Onthe Nonfire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Non Combustible By Nature ) . With Prior Approval Of Concerned Superitending Engineer. B ) Shutter:Providingof65mmthickasbestosfreecomposite-3Criteria-Fire, Heatandsmokecheck Accousticdoorshutterwithflameguardof120minutesis3614part-Iicomprisingof2x9mmcalcium Silicateboards, Chemicaltreatedinternaltimberwithfireretardantchemicalsinpressureimpregnation Vessels Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Frame Work Of 100X32 Mm With 32Mm Thick Infill Of Ceramic Fiber ( Density 128Kilograms / Cmt ) , Vermaculite Mix Facedwith6mmfireretardanthighdensityply, Internallylippedwithhardwoodbeading, Andpastedin Hydraulic Press Under 50 Tonnes Pressure, Spray Quoted With 2 Coats Of In Tumescent Paint Of Minimum 200 Micron, Andwith1rowofbrush-Typeastroflame®Intumescentstrip ( Imported ) Ofsize10mmx4mm Concealedfor Fire Andsmoke Sealing Inthe Grooves Inthe Shutter Onall Edges Except Bottom, Without Any External Lipping. 1380 Firedoor45mm1hrfrl ( 60 / 60 ) 3Criteria-Integrity / Insulation / Stabilitywoodendoor - Fire Door Tested In Accordance To Is: 3614 Part 2. Providing60 Min Fire Rated Doors System Duly Tested For 3 Criteria - Integrity, Insulation And Stability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 At National Test House, Govt Of India Laborator And / Or With Central Building Research Institute, Govt Of India Undertaking With Standard Heating Conditions As Specified Inis:3614Partii1992andbs:476Part20&221987Toachievetherequiredintegrity, Insulationand Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise Onthe Nonfire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Non Combustible By Nature ) . With Prior Approval Of Concerned Superitending Engineer. C ) Vision Panel:1 Hr Rated E Class Clear High Stress Fire Rated Glass Is Pre Fabricated Strategically Inside The Shutter Structure With 10 Mm Inside The Shutter On All Sides With U- Glazing. An Additional Insulated Powdercoated Z Channel Of 16 Swg Ms Sheet To Be Fixed For Reinforcement Of The Joints. With Clear Fire Resistant Glass Panes 11Mm Thick Having Minimum 120 Minutes Fired Iti 1381 Providing Ofaccoustic Door To Effectively Control Noise Inconference Rooms, Broadcasting Studios, Theatres And Music Practice Rooms. With Prior Approval Of Concerned Superitending Engineer. A ) Door Frame: Providing Frames For Accoustic Door Shutters With Double Rabbit Of 68Mm 1St Class Malaysian Hardwood Frame Densified And Pressure Treated With Chemicals In Vacuum Impregnation Vessel Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Of Section 120 X 70 Mm Spray Quotedwith2coatsofintumescentpaintofminimum 200Micron, With1rowofhafele Accousticseals Concealed In The Groove Of The Frame For Noise Control, Etc. Complete As Per Direction Of Engineer In Charge 1382 Providing Ofaccoustic Door To Effectively Control Noise Inconference Rooms, Broadcasting Studios, Theatres And Music Practice Rooms. With Prior Approval Of Concerned Superitending Engineer. B ) Shutter: Providing Of 65Mm Thick Accoustic Door Shutters With Wooden Structure Comprising Of Chemical Treated Internal Timber With Anti Termite Chemicals In Pressure Impregnation Vessels Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Frame Work Of 100X 48 Mm With 48 Mm Thick Infill Of Ceramic Vermiculite Mixof Density 54Kilograms / Cmt, 3Mm Sheet Rubber Interlayer Sheet On One Side For Acoustic Property, Faced With 6Mm High Density Waterproof Ply Confirming To Is Code 2201, Internallylippedwithhardwoodbeading, Andpastedinhydraulicpressunder50tonnespressure, Spray Quotedwith2coatsofpupaintofminimum200micronofcolorofengineerchoice ( Anyveneeror Lamination Will Cost Extra ) , Without Any External Lipping Along With Double Rebatting In Shutters & Accoustic Seal 1383 2 Hour Insulated, Flame, Smoke Radiation Check Lead Lined Fire Door 57Mm 2Hr Frl ( 120 / 120 ) 3 Criteria-Integrity / Insulation / Stabilitywoodendoor-Fire Doortestedinaccordance Tois: 3614 Part 2. With Prior Approval Of Concerned Superitending Engineer Providing Of120 Min Fire Rated Lead Lined Doors System Duly Tested For 3 Criteria - Integrity, Insulation And Stability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 With Standard Heating Conditions As Specified Inis:3614Partii1992andbs:476Part20&221987Toachievetherequiredintegrity, Insulationand Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise Onthe Nonfire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Noncombustiblebynature ) .Leadlinedtocheckradiation.Codeno;2Hourinsulated, Flame, Smoke Radiation Check Lead Lined Fire Door 57Mm 2Hr Frl ( 120 / 120 ) 3 Criteria - Integrity / Insulation / Stability Wooden Door - Fire Door Tested In Accordance To Is: 3614 Part 2. A ) Door Frame: Providing Frames For Lead Lined Fire Resistant Door Shutters 1St Class Malaysian Hardwood Frame Densified And Pressure Treated With Fire Retardant Chemicals In Vacuum Impregnation Vessel Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Of Section 140 X 70 Mm With45mm Thick Two Layered3mm Leadline Sheets With10mm Overlapfrom Either Side & Spray Quoted With2coatsofintumescentpaintofminimum200micron, With1rowofbrush-Typeastroflame® Intumescent Strip ( Imported ) Of Size 10Mmx4mm Concealed In The Groove Of The Frame For Fire And Hot And Cold Smoke Sealing, Etc. Complete As Per Direction Of Engineer In Charge 1384 2 Hour Insulated, Flame, Smoke Radiation Check Lead Lined Fire Door 57Mm 2Hr Frl ( 120 / 120 ) 3 Criteria-Integrity / Insulation / Stabilitywoodendoor-Fire Doortestedinaccordance Tois: 3614 Part 2. With Prior Approval Of Concerned Superitending Engineer Providing Of120 Min Fire Rated Lead Lined Doors System Duly Tested For 3 Criteria - Integrity, Insulation And Stability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 With Standard Heating Conditions As Specified Inis:3614Partii1992andbs:476Part20&221987Toachievetherequiredintegrity, Insulationand Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise Onthe Nonfire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Noncombustiblebynature ) .Leadlinedtocheckradiation.Codeno;2Hourinsulated, Flame, Smoke Radiation Check Lead Lined Fire Door 57Mm 2Hr Frl ( 120 / 120 ) 3 Criteria - Integrity / Insulation / Stability Wooden Door - Fire Door Tested In Accordance To Is: 3614 Part 2. B ) Shutter: Providing Of 57Mm Thick Asbestos Free Composite, Tufwud Brand - 3 Criteria - Fire, Heat And Smoke Check Lead Lined Door Shutter With Flame Guard Of 120 Minutes Is3614 Part -Ii Comprising Of 2X9mm Calciumsilicateboards, Chemical Treated Internal Timber With Fireretardant Chemicals In Pressure Impregnation Vessels Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Frame Work Of 100X30mm With30mm Thick Infill Of Ceramic Fibre ( Density 128Kilograms / Cmt ) Vermiculite Mix, 3Mm Thick Lead Sheet On One Side Faced& 3Mm Fire Retardant High Density Fibreboard, Internallylippedwithhardwoodbeading, Andpastedinhydraulicpressunder50tonnespressure, Spray Quotedwith2coatsofintumescentpaintofminimum300micron, Andwith1rowofbrush-Type Astroflame®Intumescentstrip ( Imported ) Ofsize 10Mmx4mm Concealedforfire Andsmoke Sealing Inthe Grooves In The Shutter On All Edges Except Bottom, Without Any External Lipping. 1385 Providing Oflead Lined Door System With 120X60 Mm Hardwood Frames, Interlayered With 3Mm Lead And 44Mm Solid Core Flush Door Shutters Conforming To The I.S. Specification 2202-1991 ( Specification For Wooden Flushdoorshutter–Solidcoretype ) , Interlayeredwith3mmleadwithpriorapprovalofconcerned Superitending Engineer. A ) Doorframe:Providingframesforleadlineddoorshutters1stclassmalaysianhardwoodframe Densifiedandpressure Treatedwithfireretardantchemicalsinvacuumimpregnationvesselunder160psi Pressure As Per Is:401 And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Of Section 120 X 70 Mm With 45Mm Thick Two Layered 3Mm Lead Line Sheets Being Overlapped From Either Side, Spray Quoted With 2 Coats Of Enamel Paint After One Coat Of White Wood Primer Of Minimum 200 Micron Etc. Complete As Per Direction Of Engineer In Charge. With Prior Approval Of Concerned Superitending Engineer. 1386 Providing Oflead Lined Door System With 120X60 Mm Hardwood Frames, Interlayered With 3Mm Lead And 44Mm Solid Core Flush Door Shutters Conforming To The I.S. Specification 2202-1991 ( Specification For Wooden Flushdoorshutter–Solidcoretype ) , Interlayeredwith3mmleadwithpriorapprovalofconcerned Superitending Engineer. B ) Shutter: Supplying Of 44Mm Solid Core Flush Door Shutters Conforming To The I.S. Specification 2202-1991 ( Specificationforwoodenflushdoorshutter–Solidcoretype ) .32Mmwoodenstructureof1stclass Hardwoodorpinewoodofatleast50mm Width, Topandbottom Railsof75mm Width, Withfillermaterial Without Any Gap Of 1St Class Hardwood, Or Pine Wood, All Chemically Treated For Termite And Borer Resistance Asperis401:2001Underminimum150psipressure, Andseasonedasperis1141:1993Uptodesired Moisturelevelasperis287, Withoneside3mmhdf&Otherside3mmlead&6Mmbwpply;Allhot- Pressed With Phenol Formaldehyde Resin, Internally Lipped With Hardwood Beading, And Pasted In Hydraulic Press Under 50 Tonnes Pressure, Spray Quoted With 2 Coats Of Enamel Paint Of Minimum 300 Micron. With Prior Approval Of Concerned Superitending Engineer. 1387 Providing And Fixing Ductile Iron Man Hole Covers / Strom Water Grating And Grating With Frame Of Various Sizes, Weight And Types And Load Bearing Capacity As Per En-124, Equivalent Necowith Prior Approval Ofconcerned Superitending Engineer. 1388 Supplying Installationtesting Andcommissoning Ofhublesscentrifugallycastironpipesasperisi15905 Equivalent To Neco Inclusive Of All Necessary Special Fitting Like Bends, Tees, And Caps, Y Bends For Cleaning Offsets, Junctions, Cowls, Etc. Lad Under Floor / Fixed On Walls And In Pipe Shafts Etc. Complete. The Quoted Rate Should Include Lead And Lifting Charges To All Levels, Necessary Scaffolding And Supports Like Hanger Supports Grip Bolts And Cv Sheet 304 Grade Clamps Etc. With Prior Approval Of Concerned Superitending Engineer. A ) 50 Mm Dia 1389 Supplying Installationtesting Andcommissoning Ofhublesscentrifugallycastironpipesasperisi15905 Equivalent To Neco Inclusive Of All Necessary Special Fitting Like Bends, Tees, And Caps, Y Bends For Cleaning Offsets, Junctions, Cowls, Etc. Lad Under Floor / Fixed On Walls And In Pipe Shafts Etc. Complete. The Quoted Rate Should Include Lead And Lifting Charges To All Levels, Necessary Scaffolding And Supports Like Hanger Supports Grip Bolts And Cv Sheet 304 Grade Clamps Etc. With Prior Approval Of Concerned Superitending Engineer. B ) 65 Mm Dia 1390 Supplying Installationtesting Andcommissoning Ofhublesscentrifugallycastironpipesasperisi15905 Equivalent To Neco Inclusive Of All Necessary Special Fitting Like Bends, Tees, And Caps, Y Bends For Cleaning Offsets, Junctions, Cowls, Etc. Lad Under Floor / Fixed On Walls And In Pipe Shafts Etc. Complete. The Quoted Rate Should Include Lead And Lifting Charges To All Levels, Necessary Scaffolding And Supports Like Hanger Supports Grip Bolts And Cv Sheet 304 Grade Clamps Etc. With Prior Approval Of Concerned Superitending Engineer. C ) 75 Mm Dia 1391 Supplying Installationtesting Andcommissoning Ofhublesscentrifugallycastironpipesasperisi15905 Equivalent To Neco Inclusive Of All Necessary Special Fitting Like Bends, Tees, And Caps, Y Bends For Cleaning Offsets, Junctions, Cowls, Etc. Lad Under Floor / Fixed On Walls And In Pipe Shafts Etc. Complete. The Quoted Rate Should Include Lead And Lifting Charges To All Levels, Necessary Scaffolding And Supports Like Hanger Supports Grip Bolts And Cv Sheet 304 Grade Clamps Etc. With Prior Approval Of Concerned Superitending Engineer. D ) 100 Mm Dia 1392 Supplying Installationtesting Andcommissoning Ofhublesscentrifugallycastironpipesasperisi15905 Equivalent To Neco Inclusive Of All Necessary Special Fitting Like Bends, Tees, And Caps, Y Bends For Cleaning Offsets, Junctions, Cowls, Etc. Lad Under Floor / Fixed On Walls And In Pipe Shafts Etc. Complete. The Quoted Rate Should Include Lead And Lifting Charges To All Levels, Necessary Scaffolding And Supports Like Hanger Supports Grip Bolts And Cv Sheet 304 Grade Clamps Etc. With Prior Approval Of Concerned Superitending Engineer. E ) 150 Mm Dia 1393 Supplying Installationtesting Andcommissoning Ofhublesscentrifugallycastironpipesasperisi15905 Equivalent To Neco Inclusive Of All Necessary Special Fitting Like Bends, Tees, And Caps, Y Bends For Cleaning Offsets, Junctions, Cowls, Etc. Lad Under Floor / Fixed On Walls And In Pipe Shafts Etc. Complete. The Quoted Rate Should Include Lead And Lifting Charges To All Levels, Necessary Scaffolding And Supports Like Hanger Supports Grip Bolts And Cv Sheet 304 Grade Clamps Etc. With Prior Approval Of Concerned Superitending Engineer. F ) 200 Mm Dia 1394 Providing & Fixing In Position, Acoustical Panelling Made Fromfabric Wrapped Compressed Polyester Fibre Nonwoven 9 Mmpanels On, 50 X 50 Mm Sal-Wood Frame Of 600 X 600 C To C Having Wooden Supports From Wall Of Required Length, In Front Of 1000 Gsm Synthetic Wool 50 Mm Thick With Chicken Mesh On Wall Side, Includingcostofrequiredcut-Outs, Decorativemouldings / Finishing-Items / Paint&Scaffolding, Asper Architectural & Acousticaldesign &Instructions &Completein All Aspects.Includingall Materialslb Fiihi Tlt 1395 Providing & Fixing In Position, Acoustical Panelling Made From Wood-Wool Board 20Mmon, 50 X 50 Mm Sal-Wood Frame Of 600 X 600 C To C Having Wooden Supports From Wall Of Required Length, In Front Of 1000 Gsmsyntheticwool50mmthickwithchickenmeshonwallside, Includingcostofrequiredcut-Outs, Decorativemouldings / Finishing-Items / Paint&Scaffolding, Asperarchitectural&Acousticaldesign& Instructions & Complete In All Aspects. Including All Materials Labour, Finishing Etc Complete 1396 Providing & Fixing In Position, Acoustical Panelling Made From Gypsum Plain 12Mm Panels On, 50 X 50 Mm Sal-Wood Frame Of 600 X 600 C To C Having Wooden Supports From Wall Of Required Length, In Front Of 1000 Gsmsyntheticwool50mmthickwithchickenmeshonwallside, Includingcostofrequiredcut-Outs, Decorativemouldings / Finishing-Items / Paint&Scaffolding, Asperarchitectural&Acousticaldesign& Instructions & Complete In All Aspects.Including All Materials Labour, Finishing Etc Complete 1397 Providing & Fixing In Position, Acoustical Panelling Made From 12Mm Wp Ply Wood & 1.5Mm Laminateon, 50 X 50 Mm Sal-Wood Frame Of 600 X 600 C To C Having Wooden Supports From Wall Of Required Length, In Front Of 1000 Gsm Synthetic Wool 50 Mm Thick With Chicken Mesh On Wall Side, Including Cost Of Required Cut-Outs, Decorativemouldings / Finishing-Items / Paint&Scaffolding, Asperarchitectural&Acoustical Design & Instructions & Complete In All Aspects.Including All Materials Labour, Finishing Etc Complete 1398 Providing & Fixing Inpositionacoustical Doors Along With150x150mm Teak Woodframe, Doors Made From 50Mm Teak Wood Frame 600 X600 C To C Filled With 1000 Gsm Synthetic Wool 50Mm Thick And 3Mm Tecsound From Both Sides, 12Mm Waterproof Ply & Veneer From Both Sides , Including 150Mm Heavy Duty Ss Hinges ( Geze / Dormaoreq. ) 4Noeachleaf, Withdoor-Closer ( Dorma / Gezeoreq. ) Includingcostof Required Cut-Outs, Decorative Mouldings / Finishing-Items / Melamine Polish & Scaffolding As Per Architectural&Acousticaldesign&Instructions&Completeinallaspects.Includingallmaterialslb Fiihi Tlt 1399 Providing & Fixing In Position Stage Flooring Made From 18Mm Plywood 1200 X 2400 & 18Mm Teakwood Planks 100 X 800 Having Tongue & Grove On Sal-Wood Frame Of 50 X 100 At 600Mm C To C On Stage Surface Including Cost Of Required Cut-Outs, Decorative Mouldings / Finishing-Items / Polish Etc., As Per Architectural & Acoustical Design & Instructions & Complete In All Aspects..Including All Materials Labour, Finishing Etccomplete 1400 Providing & Fixing In Position, Acoustical Ceiling Made From Gypsum Plain Panels On Approved Heavy Dutyg.I. Frame Ceiling Channels At 450 C To C, & Intermediate Channels Not More Than 1200 C To C, Along With Ply Woodforms Suspendedwithhangers From Roof, Infront Of 1000Gsm Syntheticwool 50Mm Thick, With Paint, Includingcostofrequiredcut-Outs, Decorativemouldings / Finishing-Items&Scaffolding, Asper Architectural & Acousticaldesign &Instructions &Completein All Aspects.Includingall Materialslb Fiihi Tlt 1401 Providing & Fixing In Position, Acoustical Ceiling Made From Compressed Polyester Fibre Nonwoven 9Mm Panels Onapprovedheavydutygiframe300mmctoc&Intermediatechannelsat1200mmctoc, Suspendedwithhangersfrom Roof, Includingcostofrequiredcut-Outs, Decorative Mouldings / Finishing- Items&Scaffolding, Asperarchitectural&Acousticaldesign&Instructions&Completeinallaspects Including All Materials Labour, Finishing Etc Complete 1402 Providing & Fixing In Position, Acoustical Ceiling Made From Rigitone 8 / 18 Perforated Panels On Approved Heavy Duty G.I. Frame, Ceiling Channels At 300C To C, & Intermediate Channelsnot More Than1200c Toc, Suspended With Hangers From Roof, In Front Of 1000 Gsm Synthetic Wool 50 Mm Thick, With Paint, Including Costofrequiredcut-Outs, Decorativemouldings / Finishing-Items&Scaffolding, Asperarchitectural& Acousticaldesign&Instructions&Completeinallaspectsincludingallmaterialslabour, Finishingetclt 1403 Providing & Fixing In Position, Acoustical Panelling Made From 12Mm Thick Agro Wood Strips Of 50, 75 7 100 Mm Width On 50 X 50 Mm Sal-Wood Frame Of 600 X 600 C To C Having Supports From Wall Of Required Length, Infrontof1000gsm Syntheticwool50mm Thickwithapprovedcolouredfabriconstripsside& Chickenmeshonwallside, Includingcostofrequiredcut-Outs, Decorativemouldings / Finishing-Items / Melamine Polish & Scaffolding, As Per Architectural & Acoustical Design & Instructions & Complete In All Aspects. Including All Materials Labour, Finishing Etc Complete 1404 Providing & Fixing In Position, Fabric Wrapped Compressed Polyester Fibre Nonwoven 9Mmpanels Above The Woodwoolboardpanelling Orexisting Salwoodframe, Using Adhesive, Asperarchitectural&Acoustical Design & Instructions & Complete In All Aspects.Including All Materials Labour, Finishing Etc Complete 1405 Providing & Fixing In Position, Partition Made From 12Mm Thick Gypsum From Both Sides On 50 X 50 Mm Sal-Wood Frame Of 600 X 600 C To C, Havingof 800 Gsm Synthetic Wool 50 Mm Thick In Between, Including Costofrequiredcut-Outs&Scaffolding, Asperarchitectural&Acousticaldesign&Instructions& Complete In All Aspects Including All Materials Labour, Finishing Etc Complete 1406 Providing & Fixing In Position, Carpetmore Than 800+ Gsm, Made With100% Stain Proof Fibres Of Approved Make Along With 5Mm Underlay As Per Architectural & Acoustical Design & Instructions & Complete In Allaspectsincluding All Materials Labour Finishing Etc Complete 1407 Providing & Fixing In Position, 1000 Mm Wide Auto-Glow Aluminium Extruded Strips On Auditorium Steps Asper Design & Instructions & Complete In All Aspects.Make Piccolo Or Nexus 1408 Providing & Fixing In Position, 12Mm Wp Ply Wood & 1.5Mm Laminatepanels Above The Fabricated Frame Onone Side , As Per Architectural & Acoustical Design & Instructions & Complete In All Aspects. Including All Materials Labour Finishing Etc Complete 1409 Providing&Fixinginposition, Msfabricationworkusingangles, Sqrtubes, Cchannelsetc Forvariouspartitionframe As Per Design & Instructions & Complete In All Aspects . Including All Materials Labour Finishing Etc Complete 1410 Providing & Fixing In Position, Under Deck Insulation For Metal Deck Using 1000 Gsm Synthetic Wool Withfixed To Deck Using Adhesive And Chicken Mesh. 1411 Providing & Fixing In Position, Heavy Duty Fully Upholstered Auditorium Chairs 520 Mm C To C Tip-Up Type. Height Of Back Should Be Less Than 1030 Mm With Plastic Protective Cover On Back And Bottom Having Teak Wood Handles. Back To Back Distance Is 1000Mm. The Auditorium Chairs Should Be Of Following Specifications1. Powder Coated Heavy Duty Ms Stand.2. Individually Moulded , Ergonomically Designedseat And Back Cushions. 3.Moulded Polyurethane Foam Cushion. Pu Foamdensity 48–52Kilograms / Cu.Mtr4. Moulded Polyurethane Foam Manufactured In Certified Iso 9001 Facilityto Ensure Consistency In Density For Longevity.5.Upholstered In Foam Laminated Stretch Sandwich Fabric For Clean Finish And Soft Comfortable Feel As Per The Colour & Pattern Selected By The Client. 6.Seat And Back Should Have Moulded Synthetic Protective Cover. 7. Wooden Or Pu Armrest65mm X 20Mm- 330Mmlong . 8.Mounted Using Anchor Fasteners. 1412 Providingandfixingrollarblindsamimakeorapprovedmake&Shadeof38mmroundaluminium Channelwithblackout Fabric& Telting Withchain ( Ball ) System Withallnecessary Fixturesandfitting Etc. Complete. ( Sample To Be Final By Engineer In-Charge Prior Execution Of Work ) 1413 Providingandfixingverticalblindsofapprovedmakeandshadeof100mmregularfabricwithpowder Coatedaluminiumchannelwithteltingpvcchain&Bottomweightplatewithallnecessaryfixturesand Fitting Etc. Complete. ( Sample To Be Final By Engineer In-Charge Prior Execution Of Work ) 1414 ExecutiveStable @ 1800Lx900dx750htproviding&Fixing Oftable @1800Lx900dx750ht-Top&Gableendtobemade Of Membrane Finish With Soft Water Fall Edges & Curved Panel & Decorated Anodizedsection Modestypanel To Be Made Of 18 Mm Thick Prelaminated Particle Board With Pvc Edge Band As Per Drawing 1415 Pedestal Unit @ 420Lx450dx650htproviding & Fixing Of Pedestal @ 420Lx450dx650ht :- To Be Made Out Of Complete Membrane Consist Of Three Drawers As Per Drawing. 1416 Credestal @ 1200Lx450lx650htproviding&Fixingoflowheightcredestal@1200Lx450dx650h :-Tobemadeoutof Membrane Finish ( 2 Openable Shutter & 3 Drawer Pedestal In Between ) As Per Drawing. 1417 Executive Table @ 2250Lx2100dx750ht Including Low Height Credestal @ 1200Lx450dx650ht Providing &Fixing Oftable @2250Lx2100dx750httop&Gableendtobemade Of Membrane Finish With Soft Water Fall Edges & Curved Panel & Decorated Anodizedsection Modestypanel To Be Madeof18mmthickprelaminatedparticleboardwithpvcedgeband.Includingcredestal@ 1200L X 450D X 650H:- To Be Made Out Of Membrane Finish ( 2 Openable Shutter & 3 Drawer Pedestal In Between ) As Per Drawing. 1418 Medium Height Partition @ 1800 / 1200Httile Based Partition System:-Tile Based Aluminum Partition System Of 1800 / 1200 Mm Ht. Made Of 60Mm Thk Aluminum Frames Having Two Separate Race Ways For Laying Electrical & Computer Wiring. The Wire Management Shall Be Through To The Race Way To Be Fitted At Bottom Of Partition And Other Immediately Belowofworktopwithhookontyperacewaycoverforeasyaccessofwires.Framestobejoinedby Aluminumconnectorswithm6x16pan-Headmachinscrewandwasherwithaluminumpostcover.Post Cover Of Snap On Fashion To Be Connected On Aluminum Connectors. All Visible Aluminium To Be In Anodized Finish. The Top / Exposedsides Of The Frame Andposts Shouldbe Coveredwithhorizontal / Vertical Trim And Caps Made Of Aluminum In Anodized Finish In Order To Enhance Its Look.Upper Tiles Of Partition To Be In Soft Board Or Marker Tile Of 9Mm. Thk., And Prelaminated Partical Board Lower Tiles In Laminate Finish Of 9Mm. Thk. On Both The Sides. 1419 Free Standing Table @ 1500Lx600dx750htproviding Andfixing Table Ofsize 1500X600x750mm.Top:Made From 25Mm Prelaminatedparticle Board.All Edges Are Covered By 2 Mm. Thk. Pvc Edge Bands Glued By Hot Melt Glue Applied By Auto Edge Banding Machine.Legs : C Shape Made From Crca Sheet With Powder Coat Finish. Modesty Panel : Made From 18Mm Both Side Prelaminated Particle Boards.All Edges Are Covered By 0.8Mm Pvcedge Bands Glued By Hot Melt Glue Appliedbyautoedgebandingmachine.Keyboardtray ( Withoutmousetray ) :- Metal Powdercoated-Blackcolor, Cputrolley:- Metalpowdercoated-Blackcolor, 3Drawer Pedestal Unit Having Overall Size 392L X 450D X 680Ht. Mm. With Central Lock And Key. Drawers And Body Are Complete Metal With Powder Coat Finish, Facia In 18 Mm Prelaminated Particle Board, 1420 Free Standing Table @ 1350Lx600dx750htproviding Andfixing Table Ofsize 1350X600x750mm.Top:Made From 25Mm Prelaminatedparticle Board.All Edges Are Covered By 2 Mm. Thk. Pvc Edge Bands Glued By Hot Melt Glue Applied By Auto Edge Banding Machine.Legs : C Shape Made From Crca Sheet With Powder Coat Finish. Modesty Panel : Made From 18Mm Both Side Prelaminated Particle Boards.All Edges Are Covered By 0.8Mm Pvcedge Bands Glued By Hot Melt Glue Appliedbyautoedgebandingmachine.Keyboardtray ( Withoutmousetray ) :- Metal Powdercoated-Blackcolor, Cputrolley:- Metalpowdercoated-Blackcolor, 3Drawer Pedestal Unit Having Overall Size 392L X 450D X 680Ht. Mm. With Central Lock And Key. Drawers And Body Are Complete Metal With Powder Coat Finish, Facia In 18 Mm Prelaminated Particle Board, 1421 Free Standing Table @ 1200Lx600dx750htproviding Andfixing Table Ofsize 1200X600x750mm.Top:Made From 25Mm Prelaminatedparticle Board.All Edges Are Covered By 2 Mm. Thk. Pvc Edge Bands Glued By Hot Melt Glue Applied By Auto Edge Banding Machine.Legs : C Shape Made From Crca Sheet With Powder Coat Finish. Modesty Panel : Made From 18Mm Both Side Prelaminated Particle Boards.All Edges Are Covered By 0.8Mm Pvcedge Bands Glued By Hot Melt Glue Appliedbyautoedgebandingmachine.Keyboardtray ( Withoutmousetray ) :- Metal Powdercoated-Blackcolor, Cputrolley:- Metalpowdercoated-Blackcolor, 3Drawer Pedestal Unit Having Overall Size 392L X 450D X 680Ht. Mm. With Central Lock And Key. Drawers And Body Are Complete Metal With Powder Coat Finish, Facia In 18 Mm Prelaminated Particle Board, 1422 Library Area Table @ 1350Lx750dx750htproviding & Fixing Of Free Standing Table @ 1350Lx750dx750ht:- Top To Be Made Of 25 Mm Thick Prelaminated Particle Board With Pvc Edge Band, Bent Leg To Be Chrome Finish As Per Drawing. 1423 Providing & Fixing Curviliner Workstation @ 1500 / 1500Lx600 / 600Dx750htproviding&Fixingcurvilinerworkstation@1500 / 1500Lx600 / 600Dx750ht, Curvilineartabletop@ 1500 / 1500Lx600 / 600D :- Top To Be Made Of 25 Mm Thick Prelaminated Particle Board With Pvc Edge Band, Gable End To Be Made Of 25 Mm Thick Prelaminated Particle Board With Pvc Edge Band, Keyboard Tray ( Without Mouse Tray ) :-Metal Powder Coated- Black Color, Cputrolley :- Metal Powder Coated - Black Color, Along With 3 Drawer Pedestal Unit Having Overall Size 392L X 450D X 680Ht. Mm. With Central Lock And Key. 3 Drawers And Body Are Complete Metal With Powder Coat Finish, Facia In 18 Mm Prelaminated Particle Board, 1424 Conference Table @ 3600Lx1400dx750htproviding & Fixing Of Main Table @ 3600Lx1400dx750ht - Made Up Of 18+18Mm Thick Mdf Top With Pvcmembranefinishandwaterfalledgeprofile.Aluminiumanodiziedfinishbeedingof4mmthichis Running All Over The Table Top Edge. Gable Ends Is Aerofoiled Shape With Front Edges In Pvc Membrane Finish Andrestinprelaminatedmdfwithbattonstructure.Gableendsshouldbehollowfrominsideforthe Provisionofpassingelectricalanddatawiring., Modestypanel:-Tobemadeof18mmthick Prelaminated Particle Board With Pvc Edge Bandafl - Fwir2 N 1425 Conference Table @ 1800 X 900 X 750 Mm Ht.Providing & Fixing Of Main Table @ 1800Lx900dx750ht- Made Up Of 18+18Mm Thick Mdf Topwith Pvcmembranefinishandwaterfalledgeprofile.Aluminiumanodiziedfinishbeedingof4mmthichis Running All Over The Table Top Edge. Gable Ends Is Aerofoiled Shape With Front Edges In Pvc Membrane Finish Andrestinprelaminatedmdfwithbattonstructure.Gableendsshouldbehollowfrominsideforthe Provisionofpassingelectricalanddatawiring., Modestypanel:-Tobemadeof18mmthick Prelaminated Particle Board With Pvc Edge Bandafl - Fwir N 1426 12 Seater Reading Table For Library @ 3600Lx1200dx750htproviding Andfixing 12Seater Reading Table Forliberary @3600Lx1200dx750httop:Made From 25 Mm Prelaminated Particle Board.All Edges Are Covered By 2 Mm. Thk. Pvc Edge Bands Glued By Hot Melt Glue Applied By Auto Edge Banding Machine.Gable Ends : Made From 25 Mm Prelaminated Particle Board.All Edges Are Covered By 2 Mm. Thk. Pvc Edge Bands Glued By Hot Melt Glue Applied By Auto Edge Banding Machine. Modesty Panel : Made From 18Mm Both Side Prelaminated Particle Boards.All Edges Are Covered By 0.8Mm Pvcedge Bands Glued By Hot Melt Gluelid B D Bdihi 1427 3 Drawer Pedestal Unit @ 392L X 450D X 680Ht. Mm.3 Drawer Pedestal Unit Having Overall Size 392L X 450D X 680Ht. Mm. With Central Lock And Key. 3 Drawers And Body Are Complete Metal With Powder Coat Finish, Facia In 18 Mm Prelaminated Particle Board. 1428 Low Height Openable Storage @ 900Lx450x750htproviding And Fixing Openable Steel Storage Of 900 X 450 X 750Ht, With 2 Adjustable Shelves, Complete Body & Shutter Made In0.8 Mm Thick & Top In 2 Mm Thick Crca, 2 Shutter To Be Mounted With The Help Of Cup Hinges, And 4 Adjustable Levelers, Enitre Storage In Powder Coated Finish With 60 To 80 Microns. With 25 Mm. Thk Additional Top On Top Of Storage As As Per Drawing 1429 Medium Height Steel Storage @ 750Lx450dx1200htproviding Andfixing Openable Steel Storage Of 750X450x1200ht, With2adjustable Shelves, Complete Body & Shutter Made In0.8 Mm Thick & Top In 2 Mm Thick Crca, 2 Shutter To Be Mounted With The Help Of Cup Hinges, And 4 Adjustable Levelers, Enitre Storage In Powder Coated Finish With 60 To 80 Microns. With 25Mmthka Per Drawing 1430 Full Height Steel Storage @ 750Lx450dx2100htproviding Andfixing Openable Steel Storage Of 750X450x2100ht, With4adjustable Shelves, Complete Body & Shutter Made In0.8 Mm Thick & Topin 2 Mm Thick Crca, 4 Shutter To Be Mounted With The Help Of Cup Hinges, And 4 Adjustable Levelers, Enitre Storage In Powder Coated Finish With 60 To 80 Microns As As Per Drawing 1431 Multiple Compartment Lockers @ 1140Lx 457D X 1830 Mm. Ht.Providing And Fixing Multiple Compartment Lockers @ 1140Lx 457D X 1830 Mm. Ht. With 12 Compartments , Complete Body & Shutter Made Of Crca Sheet With Powder Coated Finish As Per Approved Color 1432 Book Case With Glass Shutter @ 825Lx300dx1650htproviding & Fixing Of Book Case With Glass Shutter @ 825Lx300dx1650ht:- To Be Made Out Of Complete Body & In 0.7Mm Thick Crca & Shutter In 1.2Mm Thick Crca With Glass Pannel In Powder Coating Finishdi 1433 Providing&Arrangemntofhighback, Synchronizedmechanismwithmultiplelocking, Adjustable Armrest, Gaslift For Seat Height Adjustment, Standard 5-Prong P / Nylon Basewith Leatherite Upholstery 1434 Providing&Arrangemntofhighbackchair-Tiltmechanismwithmultilocking, High Densitycushiononseatcompositeleatherwithmetallicsilverfinishbaseand Arms With P.U.Castors Gaslift For Height Adjustment. 1435 Providing & Arrangemnt Of Mid Back, Normal Syncromechanism , Fixed Armrest , Gaslift For Seat Heightadjustmentstandard 5-Prong / Nylon Base With Leather Upholstery 1436 Providing&Arrangemntofmidback, Ecoctsmechanism, Fixedarmrest, Gasliftforseatheight Adjustment, Standard 5-Prong P / Nylon Base With Fabric Upholstery 1437 Public Seating Chair. - 3 Seaterproviding Andfixing 3Seater Public Seating Chair Made Of Complete Metal Withlegs Incrome Finishand Seates In Silver Powder Coating Finish. 1438 Double Faced Mobile Unit For Compactor 2150Mmh X 2745Mmw X 900Mmdproviding And Fixing Double Faced Mobile Unit For Compactor 2150Mmh X 2745Mmw X 900Mmd- Base Frame : Base Frame Shall Be Fabricated In Channel Type From Minimum 2.5 Mm Thick Mssheet Size Of Channel25mm X 100Mm X 45Mm.Guide Rails : The Guide Rails Shall Be Made Out Of 28Mm Bright Bar Placed On 1.2 Mm Thick M.S. Plate Which Will Be Above The Floor And Are As Per The International Standard Of Safety.Super Structure : Super Structure Of The Mobile Storage System Will Consist Of Knock Down Type Panels. All The Components Such As Shelves, Front Panel, End Panel, Vertical Rear Panel, Central Partition Etc. Will Act Asanintegralmemberoftheunit.Shelves:Shelvesmadeof22swgthickprimequalityc.R.C.A. Having10 Foldseachwillbeprovided Eachdesignedtocarryau.D.L.Of70kilograms.Vertical Panel: Verticalpanelconsistsofthefront, Centre&Rearpanelshallbemadeoutof20swgthickc.R.C.A. Prime Quality Mild Steel & Designed To Take The Load Of Shelves. Drive Cover Panel : Made Outof22swgthickc.R.C.A.Primequalitysteeltocovertheentiredrivemechanism.Centre Partition : The Centre Partition Will Comprise Of A Full C.R.C.A. Prime Quality Mild Steel 22Swg Sheet. Locking: Systemwillbeprovidedwithindividualracklockingaswellascentralisedlocking Arrangement On The Last Unit When All Units Are Brought Together, Central Lock When Operated Gets Locked With Thefloor&Doesnotallowaccesstotheunits.Drivemechanism : Drivingmechanism Willbe Provided Externally Supported On Special Grade Anti-Friction Bearing To Have Smooth & Effortless Movement. Entire Mechanism Or Gear & Sprockets Shall Be Incorporated Within The Front Panel Provided In The Front Of The Unit Within An Area Of 1000Mm X 200Mm X 60Mm.Driving Wheel : Fully Powder Coated Three Pronged Drive Wheel For Better Torque & Free Movement Of The Rack Over The Guide Rail. Indexing Arrangement:Acrylic Cardholdersprovidedonthefrontpanelfor Easyidentification&Retrieval.Finalfinish: Powder Coating ( 8 Tanks Process With 70 Microns ) . 1439 Single Faced Mobile Unit For Compactor 2150Mmh X 2745Mmw X 457Mmdproviding And Fixing Single Faced Mobile Unit For Compactor 2150Mmh X 2745Mmw X 457Mmd- Base Frame : Base Frame Shall Be Fabricated In Channel Type From Minimum 2.5 Mm Thick Mssheet Size Of Channel25mm X 100Mm X 45Mm.Guide Rails : The Guide Rails Shall Be Made Out Of 28Mm Bright Bar Placed On 1.2 Mm Thick M.S. Plate Which Will Be Above The Floor And Are As Per The International Standard Of Safety.Super Structure : Super Structure Of The Mobile Storage System Will Consist Of Knock Down Type Panels. All The Components Such As Shelves, Front Panel, End Panel, Vertical Rear Panel, Central Partition Etc. Will Act Asanintegralmemberoftheunit.Shelves:Shelvesmadeof22swgthickprimequalityc.R.C.A. Having10 Foldseachwillbeprovided Eachdesignedtocarryau.D.L.Of70kilograms.Vertical Panel: Verticalpanelconsistsofthefront, Centre&Rearpanelshallbemadeoutof20swgthickc.R.C.A. Prime Quality Mild Steel & Designed To Take The Load Of Shelves. Drive Cover Panel : Made Outof22swgthickc.R.C.A.Primequalitysteeltocovertheentiredrivemechanism.Centre Partition : The Centre Partition Will Comprise Of A Full C.R.C.A. Prime Quality Mild Steel 22Swg Sheet. Locking : Systemwillbeprovidedwithindividualracklockingaswellascentralisedlocking Arrangement On The Last Unit When All Units Are Brought Together, Central Lock When Operated Gets Locked With Thefloor&Doesnotallowaccesstotheunits.Drivemechanism : Drivingmechanism Willbe Provided Externally Supported On Special Grade Anti-Friction Bearing To Have Smooth & Effortless Movement. Entire Mechanism Or Gear & Sprockets Shall Be Incorporated Within The Front Panel Provided In The Front Of The Unit Within An Area Of 1000Mm X 200Mm X 60Mm.Driving Wheel : Fully Powder Coated Three Pronged Drive Wheel For Better Torque & Free Movement Of The Rack Over The Guide Rail. Indexing Arrangement:Acrylic Cardholdersprovidedonthefrontpanelfor Easyidentification&Retrieval.Finalfinish: Powder Coating ( 8 Tanks Process With 70 Microns ) . 1440 Single Faced Fixed Unit For Compactor 2150Mmh X 2745Mmw X 457Mmdproviding And Fixing Single Faced Fixed Unit For Compactor 2150Mmh X 2745Mmw X 457Mmd- Base Frame : Base Frame Shall Be Fabricated In Channel Type From Minimum 2.5 Mm Thick Mssheet Size Of Channel25mm X 100Mm X 45Mm.Guide Rails : The Guide Rails Shall Be Made Out Of 28Mm Bright Bar Placed On 1.2 Mm Thick M.S. Plate Which Will Be Above The Floor And Are As Per The International Standard Of Safety.Super Structure : Super Structure Of The Mobile Storage System Will Consist Of Knock Down Type Panels. All The Components Such As Shelves, Front Panel, End Panel, Vertical Rear Panel, Central Partition Etc. Will Act Asanintegralmemberoftheunit.Shelves:Shelvesmadeof22swgthickprimequalityc.R.C.A. Having10 Foldseachwillbeprovided Eachdesignedtocarryau.D.L.Of70kilograms.Vertical Panel: Verticalpanelconsistsofthefront, Centre&Rearpanelshallbemadeoutof20swgthickc.R.C.A. Prime Quality Mild Steel & Designed To Take The Load Of Shelves. Drive Cover Panel : Made Outof22swgthickc.R.C.A.Primequalitysteeltocovertheentiredrivemechanism.Centre Partition : The Centre Partition Will Comprise Of A Full C.R.C.A. Prime Quality Mild Steel 22Swg Sheet. Locking : Systemwillbeprovided Withindividualracklockingaswellascentralisedlocking Arrangement On The Last Unit When All Units Are Brought Together, Central Lock When Operated Gets Locked With Thefloor&Doesnotallowaccesstotheunits.Drivemechanism : Drivingmechanism Willbe Provided Externally Supported On Special Grade Anti-Friction Bearing To Have Smooth & Effortless Movement. Entire Mechanism Or Gear & Sprockets Shall Be Incorporated Within The Front Panel Provided In The Front Of The Unit Within An Area Of 1000Mm X 200Mm X 60Mm.Driving Wheel : Fully Powder Coated Three Pronged Drive Wheel For Better Torque & Free Movement Of The Rack Over The Guide Rail. Indexing Arrangement:Acrylic Cardholdersprovidedonthefrontpanelfor Easyidentification&Retrieval.Finalfinish: Powder Coating ( 8 Tanks Process With 70 Microns ) . 1441 Double Faced Mobile Unit For Compactor 2150Mmh X 1830Mmw X 900Mmdproviding And Fixing Double Faced Mobile Unit For Compactor 2150Mmh X 1830Mmw X 900Mmd- Base Frame : Base Frame Shall Be Fabricated In Channel Type From Minimum 2.5 Mm Thick Mssheet Size Of Channel25mm X 100Mm X 45Mm.Guide Rails : The Guide Rails Shall Be Made Out Of 28Mm Bright Bar Placed On 1.2 Mm Thick M.S. Plate Which Will Be Above The Floor And Are As Per The International Standard Of Safety.Super Structure : Super Structure Of The Mobile Storage System Will Consist Of Knock Down Type Panels. All The Components Such As Shelves, Front Panel, End Panel, Vertical Rear Panel, Central Partition Etc. Will Act Asanintegralmemberoftheunit.Shelves:Shelvesmadeof22swgthickprimequalityc.R.C.A. Having10 Foldseachwillbeprovided Eachdesignedtocarryau.D.L.Of70kilograms.Vertical Panel: Verticalpanelconsistsofthefront, Centre&Rearpanelshallbemadeoutof20swgthickc.R.C.A. Prime Quality Mild Steel & Designed To Take The Load Of Shelves. Drive Cover Panel : Made Outof22swgthickc.R.C.A.Primequalitysteeltocovertheentiredrivemechanism.Centre Partition : The Centre Partition Will Comprise Of A Full C.R.C.A. Prime Quality Mild Steel 22Swg Sheet. Locking: Systemwillbeprovidedwithindividualracklockingaswellascentralisedlocking Arrangement On The Last Unit When All Units Are Brought Together, Central Lock When Operated Gets Locked With Thefloor&Doesnotallowaccesstotheunits.Drivemechanism : Drivingmechanism Willbe Provided Externally Supported On Special Grade Anti-Friction Bearing To Have Smooth & Effortless Movement. Entire Mechanism Or Gear & Sprockets Shall Be Incorporated Within The Front Panel Provided In The Front Of The Unit Within An Area Of 1000Mm X 200Mm X 60Mm.Driving Wheel : Fully Powder Coated Three Pronged Drive Wheel For Better Torque & Free Movement Of The Rack Over The Guide Rail. Indexing Arrangement:Acrylic Cardholdersprovidedonthefrontpanelfor Easyidentification&Retrieval.Finalfinish: Powder Coating ( 8 Tanks Process With 70 Microns ) . 1442 Single Faced Mobile Unit For Compactor 2150Mmh X 1830Mmw X 457Mmdproviding And Fixing Single Faced Mobile Unit For Compactor 2150Mmh X 1830Mmw X 457Mmd- Base Frame : Base Frame Shall Be Fabricated In Channel Type From Minimum 2.5 Mm Thick Mssheet Size Of Channel25mm X 100Mm X 45Mm.Guide Rails : The Guide Rails Shall Be Made Out Of 28Mm Bright Bar Placed On 1.2 Mm Thick M.S. Plate Which Will Be Above The Floor And Are As Per The International Standard Of Safety.Super Structure : Super Structure Of The Mobile Storage System Will Consist Of Knock Down Type Panels. All The Components Such As Shelves, Front Panel, End Panel, Vertical Rear Panel, Central Partition Etc. Will Act Asanintegralmemberoftheunit.Shelves:Shelvesmadeof22swgthickprimequalityc.R.C.A. Having10 Foldseachwillbeprovided Eachdesignedtocarryau.D.L.Of70kilograms.Vertical Panel: Verticalpanelconsistsofthefront, Centre&Rearpanelshallbemadeoutof20swgthickc.R.C.A. Prime Quality Mild Steel & Designed To Take The Load Of Shelves. Drive Cover Panel : Made Outof22swgthickc.R.C.A.Primequalitysteeltocovertheentiredrivemechanism.Centre Partition : The Centre Partition Will Comprise Of A Full C.R.C.A. Prime Quality Mild Steel 22Swg Sheet. Locking: Systemwillbeprovidedwithindividualracklockingaswellascentralisedlocking Arrangement On The Last Unit When All Units Are Brought Together, Central Lock When Operated Gets Locked With Thefloor&Doesnotallowaccesstotheunits.Drivemechanism : Drivingmechanism Willbe Provided Externally Supported On Special Grade Anti-Friction Bearing To Have Smooth & Effortless Movement. Entire Mechanism Or Gear & Sprockets Shall Be Incorporated Within The Front Panel Provided In The Front Of The Unit Within An Area Of 1000Mm X 200Mm X 60Mm.Driving Wheel : Fully Powder Coated Three Pronged Drive Wheel For Better Torque & Free Movement Of The Rack Over The Guide Rail. Indexing Arrangement:Acrylic Cardholdersprovidedonthefrontpanelfor Easyidentification&Retrieval.Finalfinish: Powder Coating ( 8 Tanks Process With 70 Microns ) . 1443 Single Faced Fixed Unit For Compactor 2150Mmh X 1830Mmw X 457Mmdproviding And Fixing Single Faced Fixed Unit For Compactor 2150Mmh X 1830Mmw X 457Mmd- Base Frame : Base Frame Shall Be Fabricated In Channel Type From Minimum 2.5 Mm Thick Mssheet Size Of Channel25mm X 100Mm X 45Mm.Guide Rails : The Guide Rails Shall Be Made Out Of 28Mm Bright Bar Placed On 1.2 Mm Thick M.S. Plate Which Will Be Above The Floor And Are As Per The International Standard Of Safety.Super Structure : Super Structure Of The Mobile Storage System Will Consist Of Knock Down Type Panels. All The Components Such As Shelves, Front Panel, End Panel, Vertical Rear Panel, Central Partition Etc. Will Act Asanintegralmemberoftheunit.Shelves:Shelvesmadeof22swgthickprimequalityc.R.C.A. Having10 Foldseachwillbeprovided Eachdesignedtocarryau.D.L.Of70kilograms.Vertical Panel: Verticalpanelconsistsofthefront, Centre&Rearpanelshallbemadeoutof20swgthickc.R.C.A. Prime Quality Mild Steel & Designed To Take The Load Of Shelves. Drive Cover Panel : Made Outof22swgthickc.R.C.A.Primequalitysteeltocovertheentiredrivemechanism.Centre Partition : The Centre Partition Will Comprise Of A Full C.R.C.A. Prime Quality Mild Steel 22Swg Sheet. Locking: Systemwillbeprovidedwithindividualracklockingaswellascentralisedlocking Arrangement On The Last Unit When All Units Are Brought Together, Central Lock When Operated Gets Locked With Thefloor&Doesnotallowaccesstotheunits.Drivemechanism : Drivingmechanism Willbe Provided Externally Supported On Special Grade Anti-Friction Bearing To Have Smooth & Effortless Movement. Entire Mechanism Or Gear & Sprockets Shall Be Incorporated Within The Front Panel Provided In The Front Of The Unit Within An Area Of 1000Mm X 200Mm X 60Mm.Driving Wheel : Fully Powder Coated Three Pronged Drive Wheel For Better Torque & Free Movement Of The Rack Over The Guide Rail. Indexing Arrangement:Acrylic Cardholdersprovidedonthefrontpanelfor Easyidentification&Retrieval.Finalfinish: Powder Coating ( 8 Tanks Process With 70 Microns ) . 1444 Stool For Lab And Class-Ivproviding And Fixing 4 Legged Lab Stool, Legs Made Of 16 Guage 45 Mm Outer Dimension Ms Pipe, Duly Painted, Witha304grade Stainlesssteel12inchwide Seatwitha1inchcollar, Heightadjustmentviaa Screw. As Per Design And Drawing And Instructions Of Engineer In Charge. 1445 Alluminium Foldable Ladder For Storeproviding & Fixing Foldable Alluminum Ladder 1500 Mm. Ht. 1446 Sofa Set 3+1+1Providing & Fixingsofa Set 3+1+1 Brown And Cream Leather Dimension Length: 182.5 ( Cms ) Breadth ( Cms ) : 100 ( Cms ) Height ( Cms ) : 100 ( Cms ) Weight ( Kilograms ) : 66 ( Kilogram ) Seating Capacity: Five Seat 1447 Tea Table 900Mm X 750Mm X 450Mm For M.S. Ante Chamberprovidingandfixingofteatable900mmx750mmx450mmwith12mmthickcoloureitched Tempered Glass With Bevelled Drawing Made Outof 18Mm Thick Waterproofing Ply. The Outer Laces To Be Finished With High Quality 4 Mm Thik Veneer Or 1 Mm Thik Mica Etc. 1448 Single Bed @ 2025Lx 1000Dx 650Hproviding Andfixing Single Bedofsize 2025Lx1000dx650h Withmatressandpillow.Understructure:- The Legs Are Made Of Square Tube Of Size 25 X 25Mm Made Out Of Ms With A Thickness Of 1.2 Mm. The Legs Should Have Corner Brackets Welded To It At Two Levels. The Corner Brackets Are Made Of 2Mm Thick Crca Havingalshapedstructuretojointhesidepanelsandheadboardtotheleg.Threenos.Ofhorizontal Stiffeners Are Provided At Equal Intervals. The Stiffeners Are Made Of Square Tube Of Size 25 X 25Mm Made Out Of Ms With A Thickness Of 1.2Mm. The Middle Horizontal Stiffener Has A Leg Attached To It To Transfer The Load To The Ground And Add To The Strength And Stability Of The Complete Structure. This Leg Is Also Made Of Square Tube Of Size 25 X 25Mm Made Out Of Ms With A Thickness Of 1.2Mm. All Metal Components To Undergo 7 Tank Treatment Process And Should Be Powder Coated To The Thickness Of Minimum 50 Microns Dft.Side Panel: - The Side Panels Are Made Upof 18Mm Thick Prelam Particle Boardwithboth Side Decorative Laminate. All Exposed Edges Are Sealed With 2Mm Thick Pvc Edge Banding. The Overall Width Of The Side Panel Is 150Mm. The Side Panels Have 18Mm Thick Prelam Particle Board Baton Running For Required Length To Add Rigidity To The Structure.Headboard:- The Head Boardis Made Up Of 18Mm Thick Prelam Particle Board Withboth Side Decorative Laminate.Allexposededgesaresealedwith2mmthickpvcedgebanding.Theheadboardsizetobe Considered As 1000 X 650Mm.Footboard:-Thefootboardismadeupof18mm Thickprelam Particleboardwithbothsidedecorative Laminate.Allexposededgesaresealedwith2mmthickpvcedgebanding.Theheadboardsizetobe Considered As 1000 X 450Mm.Bed Base: - The Bed Base Is Made Up Of 12Mm Thick Prelam Particle Board With Both Side White Laminate. 1449 Dressing Table @400Lx 400Dx 1800Hproviding&Fixingdressingtableofsize400lx400dx1800h.Thedressingtableunitismadeupof 18Mm Thick Prelam Particle Board With Both Side Decorative Laminate. All Exposed Edges Are Sealed With 2Mm Thick Pvcedge Banding. The Unit Has One Drawer Andone Shelf. The Dressing Table Has Amirror Of4mm Thick Pasted On 18Mm Thick Prelm Particle Board Attached To The Base Unit. The Mirror Size Considered Is 1155 X 360 X 4 ( T ) . The Mirror Has Been Pasted Using High Quality 3M Sticker. 1450 Wardrobe With Mirror @ 900Lx 600Dx 1965Hproviding And Fixing Wardrobe With Mirror Of Size 900Lx 600Dx 1965Hthe Wardrobe Side Panels And Doorsaremadeupof18mmthickprelamparticleboardwithbothsidedecorativelaminate.Allexposed Edges Are Sealed With 2Mm Thick Pvc Edge Banding. The Shelves Are Made Of 18Mm Thick Prelam Particle Board With Decorative Laminate On Both Sides. The Top Is Made Of 36Mm Prelam Particle Board With Decorative Laminate On Both Sides. ( 18Mm Prelam Particle Board And 18Mm Batons On All Sides To Achieve 36Mm Overall Thickness ) . The Exposed Edges Of The Top Are Sealed With 2Mm Thick Pvc Edge Banding. The Top Most Part Of The Wardrobe Has An Aluminum Hanger Rod Of Ebco Make. One Drawer Of Size 400 ( W ) X 150 ( H ) X 450 ( D ) Made Of 18Mm Thick Prelam Particle Board Has Been Considered. The Drawer Will Have A Multipurpose Lock Of Ebcopremiummake.Thewardrobehandlesaresatinssfinishof160mmpitch.Thewardrobehasa Multipurpose Lock Of Ebco Make. All Hinges Considered Are Hettich Make. Necessary Good Quality Hardwares Have Been Considered As Required. 1451 Bed Side Table @ 400Lx 400Dx 415Hproviding And Fixing Bed Side Table Of Size 400Lx 400Dx 415H The Bed Side Unit Is Made Up Of 18Mm Thick Prelam Particle Board With Both Side Decorative Laminate. All Exposed Edges Are Sealed With 2Mm Thick Pvc Edge Banding. The Bed Side Table Has One Drawer And One Shelf. The Shelf Is Made Of 18Mm Thick Prelam Particle Board With Both Side Decorative Laminate. All Exposed Edges Are Sealed With 2Mm Thick Pvc Edge Banding 1452 Kitchen Trolleyprovidingandfixingstainlesssteelkitchentrolleyofoverall26Heightand22Depth, Supportedon Aluminium Pipes , Trolley Basket Made Out Of 5 Mm Stainless Steel Rod Fitted On Telescopic Channel Of Size 1.5 X 20 X 22 On Both Sides Of Trolley Of 12 Or Above Size, Panel Having 40Kilogramload Bearing Capacity Of Trolley Made Out Of 20 Mm Puc Coated Plywood And Colour Combination As Directed By E-I-C.Inner Side Of Panel Covered By White Mica , 100 Mms.S. Decorativehandle. ( The Width And Height Of Individual Compartments Shall Be Kept As Directed By Engineer-In-Charge ) 1453 Solid Core Flush Door Single Leafprovidingandfixingfactorymadesolid Coreflushdoorinsingleleaf35mmthick, Decorativetypes, Of Exterior Grade, As Per Detailed Drawings, Conforming To I.S.:2202 - 1962 ( Revised ) With Approved Face Veneers On Both Faces With / Without Glazing And Venetians In The Positions Shown On The Drawings Or As Directed, All Necessarybeads, Mouldingandlipping, Holdfasts, Matfinishstainlesssteelfixturesfastenings, Finishing Withfrench-Polish / Waxingcomplete. ( Withoutdoorframe ) . ( Sampletobegotapprovedfromex.Engineer Before Use ) Commercial Hard Wood Shutter 1454 Solid Core Flush Door Double Leafproviding And Fixing Factory Made Solid Core Flush Door Shutters In Double Leaves 35Mm Thick, Decorative Type Ofexterior Grade, As Perdetaileddrawings, Conforming Toi.S.: 2202–1966 ( Revised ) Including Approved Face Veneersonbothsides, Withoutglazing Andvenetiansincluding Matfinishstainlesssteel Fixturesand Fastening, Stoppers And Finishing With French Polishing Etc. ( Excluding Door Frame ) ( Sample To Be Got Approved From Ex. Engineer Before Use ) Commercial Hard Wood Shutter 1455 Providing Silica Plaster Plaster Externally In Two Coats In All Positions Including Base Coat Of 8 To 10 Mm Thick Curing The Same For Not Less Than Two Days And Keeping The Surface Of Base Coat Rough To Receive The Final Coat Treatment 5 To 7 Mm Thick .Finishing The Surface By Taking Out Grains And Curing For 8 To 10 Daysscaffolding Etc Complete. ( Thesilicaplastmaterialshallcontain53gradeopccementwithpozzolanicmaterials.Sizeof Agreegates Shall Be Of 3 Mm Having 1:3 Proportion With Cement. 1456 Providing And Fixing Toilet Set For Differently Abled Persons Consist Of Floor Mounted White Vitreous China Waterclosetincluding6litrecapacitywhitevitreouschinaflushingcisternwithraisedsoft-Pushbutton, White Vitreous China Wash Basin Of Size 46 X 36 Cm And One No Ss304 Hingedrail 76Cms & Three No Ss 304Of ( Grab Bar ) 60 Cms All Including Cutting And Making Good The Walls And Floors Wherever Required , Seat Cover, Cistern&Washbasinfittings, Nuts, Boltsandgasketetc Complete As Perthe Directionof Engineer-In-Charge. 1457 Providingandfixingisimarkeddoubleswingflushdoorshuttersconformingtois:2202 ( Parti ) Non- Decorative Type, Core Of Block Board Construction With Frame Of 1St Class Hard Wood And Well Matched Teak 3 Plyveneering Withverticalgrainsorcrossbandsandfaceveneersonbothfacesofshutters.30Mm Thick Including Isi Marked Stainless Steel L- Hinges With Necessary Screws Fittings & Fixturesper Leafss Kick Plates On Both Sides Of The Door Of 300Mm Heightheavy Duty Satin Finish Butt Ss Hinges ( 100Mm X 75Mm X 3Mm In Size ) -4 Nos. Ss Finishedlever Handle With Mortise Lock- 1 Numberfloor Spring- 1 Number 100Mm X 100Mm Safety Glass At The Specified Location 1458 Providing And Applying Blue And White Coloured Thermoplastic Road Marking Paints For Marking A 3Ft X 3 Ft Universal Accessibility Symbol Within The Parking Bay As Paer The Drawings And Up To The Satisfaction Of Theengineer In Charge. 1459 Acrylic Tactile Audio Mapdesign, Supply, Fabrication And Fixing Of Acrylic, Non Glare, Tactile Audio Pictorialbuildinglayout As Per The Approved Size, Design And Make, Having 6Mm Thick Acrylic Non Glare Base Plate Of The Approved Colour And Non Glare Acrylic Cut Out Symbols And Upper Case Sans Serif Letters Of 12Mm Height, Raised 3Mm Above Base Plate And Grade 2 / Grade 1 Braille To Be Integral With The Sign Face And Be Raised 0.5Mm Above Base Plate. The Map To Be Installed At The Specified Location As Per Accessibility Standards, Shall Be Oriented To The Position Of Theviewerandtobeinstalledataheightof800mmfrom Thefinishedground / Floorlevelandusingthe Necessary Hardware Specified By The Manufacturer And To Be Installed Up To The Satisfaction Of The Engineer In Charge 1460 Directional Signagedesign, Supply, Fabrication And Fixing Acrylic Multilingual Braille ( Raised Dots ) Directional Signboards Of Size 6 X 9Designed As Per Accessibility Standards And Having 4Mm Thick Acrylic Base Plate With Upper Case San Serif Words Made Of White Acrylic Non Glare Cut Out Letters Of Height 15Mm Raised Not Less Than 0.8Mm Above Base Plate And The Equivalent Word Written In Hindi With Devnagri Non Glare Acrylic Letters Of Height 15Mm Raised Not Less Than 0.8Mm Above Base Plate And Having A Non Glare Acrylic Cut Arrow Pointing In The Required Direction. Each Signboard To Be Fixed As Per Manufacturers Specifications On The Wall At The Approved Location And At A Height Of 1200Mm From Ffl And As Per The Directions By The Engineer In Charge. 1461 Floor Directories Providing And Fixing Acrylic Multilingual Braille ( Raised Dots ) Ada Compliant Modularfloor Directories System On All Floors Of Size1.5 X 2 , Showing The Floor Plan And The List Of Rooms On That Floor, To Be Installed On Each Floor Near The Staircase, Designed As Per Standards And Having 4Mm Thick Blue Acrylic Base Plate With Upper Case San Serif Words And Symbols Made Of White Acrylic Non Glare Cut Out Letters Of Height 20Mm Raised Not Less Than 0.8Mm Above Base Plate And The Equivalent Word / S Written In Hindi With Devnagri Non Glare Imported Acrylic Letters Of Height 15Mm Raised Not Less Than 0.8Mm Above Base Plate. Grade 2 / Grade 1 Braille To Be Integral With The Sign Face And Be Raised 0.5Mm Above Base Plate.Each Directory To Be Fixed As Per Manufacturers Specifications On The Wall At The Approved Location At A Height Of 1200Mm From Ffl And As Per The Directions By The Engineer In Charge. 1462 Providing An Ada Compliant Disability Service Desk Having A Lowered Portion ( 800Mm From Ffl ) Andleg Space Of 450 Mm, Having The Approved Design And Of The Approved Make As Per Manufacturers Specifications 1463 Providing And Fixing Ss-304 Studs Having 35Mm Dia. Of The Approved Brand And Make Inside The Building On All Floors In Corridors, Lobbies Level Differences Etc. As Per Accessibility Standards And As Per The Installation Instructions Prescribed By The Manufacturer, Using The Necessary Adhesive Including Finishing Work Up To The Satisfaction Of The Engineer In Charge Complete. 1464 Providingandfixingss-304Stripsofsize280mmx35mmoftheapprovedbrandandmakeinsidethe Building On All Floors In Corridors, Lobbies Level Differences Etc. As Per Accessibility Standards And As Per The Installation Instructions Prescribed By The Manufacturer, Using The Necessary Adhesive Including Finishing Work Up To The Satisfaction Of The Engineer In Charge Complete. 1465 Providingandfixingbraille Indicatorsforhandrailsoftheapproveddesignandmakehaving Brailledots Raised 0.5Mm Above Base Plate, To Be Installed At The Specified Locations As Per The Directions Of The Engineer In Charge 1466 Providing And Fixing Stainless Steel ( Grade 304 ) Railing Made Of Hollow Tubes, Channels, Plates Etc. Including Weldinggrinding, Buffing, Polishingandmakingcurvature ( Whereverrequired ) Andfittingthesamewith Necessary Stainless Steel Nuts And Bolts Complete, I / C Fixing The Railing With Necessary Accessories And Stainless Steel Dash Fasteners, Stainless Steel Bolts, Etc. Of The Required Size On The Top Of The Floor Of The Side Of Waiste Slab With Suitable Arrangement As Per Approval Of Engineer In Charge ( For Payment Purpose, Only The Weight Of The Stainless Steel Members Shall Be Considered Excluding Fixing Accessories Such As Nut Bolts, Fasteners Etc. ) . 50Mm Dia. Pipe, 1.5Mm Thickness And Weight 1.92Kilogram / R. Metre 1467 Adacompliantmodularmultilingualandtactileemergencyevacuationmapofeachfloorindicatingthe CurrentpositionoftheviewersayingYouarehereOf15mmheightlettersinredwithwhite Backilogramround, Indicating The Emergency Exits, Locations Of Fire Extinguishers Etc.Signs Shall Have A Solid Header With The Text?Evacuation Plan?In Contrasting Uppercase Letters No Less Than 3 / 4 In Height. The Sizeoftheboardshallbe2ftx2ftandshallbeinstalledataheightof1200mmfrom Ffl Andshallbe Oriented To The Position Of The Viewer As Per The Direction Of The Site Engineer 1468 Fire Exit Andfloor Identificationsignage As Per ManufacturerS Specifications, Adacompliant Andmodularsystem 1469 Supplying And Installing Of In Position The Signages Fire Order It Should Contain The Following Matter On3mmthickOpaquePvcfoamboardofcomputerizedcut, Pvcnon-Reflectiveselfadhesivevinyle Painted Foam Board Of 3 X 4.Product To Be Ada Compliant And Modular System. 1470 Providing An Emergency Evacuation Chair Of The Approved Design, Weight And Loading Capacity 1471 Providing And Fixing The Reader Of The Approved Brand And Make As Per The Manufacturers Specifications And Asper The Directions Of The Engineer In Charge 1472 Providing And Fixing The Transmitter Of The Approved Brand And Make On Each Floor As Per The Manufacturersspecifications And As Per The Directions Of The Engineer In Charge 1473 Providing And Fixing Ss Braille Buttons In The Elevator Of The Approved Brand And Make To Be Installed Using The Specified Adhesive And As Per The Instructions Given By The Manufacturer 1474 Providing Andfixing Of Highintensity Reflective Conspicuity Tape 25To 50Mm Width, Onedges Of Treads Instaircase Including, Cutting, Pasting Etc. Of Make 3M Or Equivalent Brand As Per The Direction Of Engineer In Charge 1475 Providing A Folding Wheelchair Of Pioneer Surgicals Brand, Model Number Ps 809 / Equivalent Make As Perthe Directions Of The Engineer In Charge. 1476 Design, Supply, Fabricationandfixingofss, Nonglaresignageboard ( 2Ft.X2ft.-1Number ) Forthe Accessible Parking, As Per The Approved Designand Make, Having 1.2Mm Thick Ssnon Glare Base Plate And Grade 2 / Grade 1 Braille ( Raised Dots ) To Be Etched / Engraved And Be Raised 0.5Mm Above Base Plateand Upper Case San Serif Words And Universal Accessibility Symbol To Be Etched / Engraved And Signage To Be Installed At A Height Of 2100Mm From The Ground Level Using A Post Of Ms Hollow Square Section ( 50Mm X 50Mm ) As Per The Installation Procedure Specified By The Manufacturer And As Per Accessibility Standards And Up To The Satisfaction Of The Engineer In Charge. 1477 Design, Supply, Fabrication And Fixing Of Ss, Non Glare Multilingual Braille ( Raised Dots ) Entrance Signage ( Size 1 Ft X 1 Ft ) As Per The Approved Design And Make, Indicating The Name Of The Building. Having 1.2Mm Thick Ss Non Glare Blue Coloured Base Plate With The Universal Accessibility Symbol And Upper Case Sans Serif Words Of Height 15Mm Engraved On It Along With The Equivalent Word / S Written In Hindi Using Devnagri Script Of Height 15Mm In White Colour. Grade 2 / Grade 1 Braille To Be Etched / Engraved And Be Raised 0.5Mm Above Base Plate.The Signage To Be Installed At The Specified Location On The Compound Wall Near The Site Entrance Gateinstalledataheightof1200mm From The Finishedground / Floorlevel, Usingthe Necessaryhardware Specified By The Manufacturer And To Be Installed Up To The Satisfaction Of The Engineer In Charge. 1478 Providing And Laying In Place 300Mm X 300Mm X 16Mm Cement Tactile Directional And Warning Tiles ( For A Person With Visual Impairment ) Of The Approved Brand And Make And Specified Colour For Outdoor Floors Such As Footpath, Courtyard, Multimodals Location Etc. Laid On 20Mm Thick Base Of Cement Mortar 1:4 ( 1 Cement: 4 Coarsesand ) Inallshapesandpatternsincludinggroutingthejointswithwhitecementwithmatching Pigments Etc. Complete As Per Direction Of Engineer In Charge 1479 Providing And Laying In Place 300Mm X 300Mm X 9.8Mm Vitrified Tactile Warning And Directional Tiles Of The Approved Brand, Make And Colour Inside The Buildings At In All Corridors And Lobbies, Level Differences Etc. As Per Accessibility Standards Andas Per The Installationinstructions Prescribedbythe Manufacturerincluding Zarri Making Wherever Required And Finishing Including Grouting The Joints With White Cement With Matching Pigments Etc. Up To The Satisfaction Of The Engineer In Charge Complete. 1480 Design, Supply, Fabrication And Fixing Acrylic Multilingual Braille ( Raised Dots ) Signboards Of Size 6X 9 For Room Titles, Designedas Per The Drawings Issuedandhaving 4Mm Thick Blue Acrylic Base Plate Withupper Case Sanserifwordsmadeofwhiteacrylicnonglare Cutoutlettersofheight15mm Raisednotlessthan 0.8Mm Above Base Plate And The Equivalent Word / S Written In Hindi With Devnagri Non Glare Acrylic Letters Of Height 15Mm Raised Not Less Than 0.8Mm Above Base Plate. Grade 2 / Grade 1 Braille To Be Integral With The Sign Face And Be Raised 0.5Mm Above Base Plate.Each Signboard To Be Fixed As Per Manufacturers Specifications On The Wall Adjoining The Respective Room Door At A Height Of 1200Mm From Ffl And As Per The Directions By The Engineer In Charge. 1481 Providingandfixinginplace300mmx300mmx3mmpolyurethanestickontactiledirectionaltilesand Warningtileshavingbevelededgesandoftheapprovedbrand, Makeandcolourandconformingtoiso 23599:2012 Insidethebuildingonallfloorsincorridors, Lobbies, Leveldifferencesasperaccessibility Standards And To Be Installed As Per The Installation Instructionsgiven By The Manufacturer Using Butyl Rubber Adhesiveandthehardwarespecifiedbythemanufacturer, Asperthedirectionoftheengineerinchargeomplte 1482 Grabbars-Providingssgrabbarssetforaccessibletoiletscomprisingof4nos.Grabbarsasspecified Below. ( 1Nos. Wing Grabbar + 1Nos.Lshapedgrabbar+ 2Nos. Straightgrabbars= 1Typical Set ) 27A ) Swing Grab Bar ( 1 Nos ) Providing A S.S. 304 Swing Handicap Grab Bar - 700 Mm And Of Dia: 32Mm And Thickness 1.5Mm Of The Roved Brand And Make. 27B ) L Shaped Grab Bar ( 1 Nos ) Providings.S. 304 L Shaped Disabled Grab Barof Ize-600Mm ( H ) X600mm ( D ) And 32Mm Dia. And Thicknessmm Of The Approved Brand And Make.27C ) Straight Grab Bar ( 2 Nos ) Providing S.Steel 304 Grab Rail ( 600 Mm ) , 32Mm Dia. And Thickness 1.5Mm Of The Approved Brand And Make. 1483 Providingandfixingaccessiblewayfindingandnavigationsignagesystems-Providingandfixingin Locationas Diectedby Engineer In Charge, Accessible Modular Wayfinding Andnavigational Signage System Comprising Of Ada And Harmonised Guidelines Compliant Sigange And Wayfinding Elements, In Multilingual, Tactile And Braille Format. Sigange Systems To Be Designed For Entire Building / Complex Under Consideration 1484 Providing & Fixing Factory-Made Steel Door Of Single Leaf External Embossed Wood Finish Type With A. ) Frame Of Size 100X58 Mm Conforming To Is : 4351-2003 , 1.2 Mm Thick Pre Galvanized Sheet With Mitred And Welded Cones, Framestretches, Hingereinforcingplates, Fixingplates And Hardware Mountingplates And Polyurethane Foam Infill B. ) Shutter Of Thickness 46Mm Made Of 0.8 Mm Thick Slip Coated Pre Galvanized Steel Sheet On Both Sides Conforming To Astm A527 / Astm A525, Bs 2989 1994, Is 277 , Zinc Coating 120 Gsm.Lockformedpanelswithinternalstiffenersof3mmthickmadeofgalvanizedsheet, 3Mmthickhinge Reinforcing Hardware Mounting Plates And Lock Protection With Honey-Comb Craft Paper Infill Of Thickness 150 Gsm Of Load Bearing Capacity 500 Kilogram / Square Metre. C. ) Finish: Powder Coated Surface Finished With Thermosetting Polyurethane Paint Of Aliphatic Grade Of Thickness 60-Micron D. ) Accessories: Min 8 Anchor Fastener Of Hilti Make, Min 3 Ss Ball Bearing Butt Hinges Of Dorset Make, Dorset Mortise Lock, Ss Tower Bolt Of 200 Mm Size, Eye Hole, Door Stopper Complete. 1485 Providing & Fixing Factory-Made Steel Door Of Single Leaf External Plain Wood Finish Type With A. ) Frame Of Size 100X58 Mm Conforming To Is : 4351-2003 , 1.2 Mm Thick Pre Galvanized Sheet With Mitred And Welded Cones, Framestretches, Hingereinforcingplates, Fixingplates And Hardware Mountingplates And Polyurethane Foam Infill B. ) Shutter Of Thickness 46Mm Made Of 0.8 Mm Thick Slip Coated Pre Galvanized Steel Sheet On Both Sides Conforming To Astm A527 / Astm A525, Bs 2989 1994, Is 277 , Zinc Coating 120 Gsm.Lockformedpanelswithinternalstiffenersof3mmthickmadeofgalvanizedsheet, 3Mmthickhinge Reinforcing Hardware Mounting Plates And Lock Protection With Honey-Comb Craft Paper Infill Of Thickness 150 Gsm Of Load Bearing Capacity 500 Kilogram / Square Metre. C. ) Finish: Powder Coated Surface Finished With Thermosetting Polyurethane Paint Of Aliphatic Grade Of Thickness 60-Micron D. ) Accessories: Min 8 Anchor Fastener Of Hilti Make, Min 3 Ss Ball Bearing Butt Hinges Of Dorset Make, Dorset Mortise Lock, Ss Tower Bolt Of 200 Mm Size, Eye Hole, Door Stopper Complete.Sizes Up To 1200 X2439 Mm 1486 Providing & Fixing Factory-Made Steel Door Of Single Leaf External Plain Wood Finish Type With A. ) Frame Of Size 100X58 Mm Conforming To Is : 4351-2003 , 1.2 Mm Thick Pre Galvanized Sheet With Mitred And Welded Cones, Framestretches, Hingereinforcingplates, Fixingplates And Hardware Mountingplates And Polyurethane Foam Infill B. ) Shutter Of Thickness 46Mm Made Of 0.8 Mm Thick Slip Coated Pre Galvanized Steel Sheet On Both Sides Conforming To Astm A527 / Astm A525, Bs 2989 1994, Is 277 , Zinc Coating 120 Gsm.Lockformedpanelswithinternalstiffenersof3mmthickmadeofgalvanizedsheet, 3Mmthickhinge Reinforcing Hardware Mounting Plates And Lock Protection With Honey-Comb Craft Paper Infill Of Thickness 150 Gsm Of Load Bearing Capacity 500 Kilogram / Square Metre. C. ) Finish: Powder Coated Surface Finished With Thermosetting Polyurethane Paint Of Aliphatic Grade Of Thickness 60-Micron D. ) Accessories: Min 8 Anchor Fastener Of Hilti Make, Min 3 Ss Ball Bearing Butt Hinges Of Dorset Make, Dorset Mortise Lock, Ss Tower Bolt Of 200 Mm Size, Eye Hole, Door Stopper Complete.Sizes Up To 1200 X2439 Mm 1487 Providing & Fixing Factory-Made Steel Door Of Single Leaf Internal Plain Wood Finish Type With A. ) Frame Of Size 100X58 Mm Conforming To Is : 4351-2003 , 1.2 Mm Thick Pre Galvanized Sheet With Mitred And Welded Cones, Framestretches, Hingereinforcingplates, Fixingplates And Hardware Mountingplates And Polyurethane Foam Infill B. ) Shutter Of Thickness 46Mm Made Of 0.8 Mm Thick Slip Coated Pre Galvanized Steel Sheet On Both Sides Conforming To Astm A527 / Astm A525, Bs 2989 1994, Is 277 , Zinc Coating 120 Gsm.Lockformedpanelswithinternalstiffenersof3mmthickmadeofgalvanizedsheet, 3Mmthickhinge Reinforcing Hardware Mounting Plates And Lock Protection With Honey-Comb Craft Paper Infill Of Thickness 150 Gsm Of Load Bearing Capacity 500 Kilogram / Square Metre. C. ) Finish: Powder Coated Surface Finished With Thermosetting Polyurethane Paint Of Aliphatic Grade Of Thickness 60-Micron D. ) Accessories: Min 8 Anchor Fastenerofhiltimake, Min3ssballbearingbutthingesofdorsetmake, Dorsetcylindricallock, Ss Tower Bolt Of 200 Mm Size, Door Stopper Complete. 1488 Providing & Fixing Factory-Made Steel Door Of Single Leaf Internal Plain Steel Finish Type With A. ) Frame Of Size 100X58 Mm Conforming To Is : 4351-2003 , 1.2 Mm Thick Pre Galvanized Sheet With Mitred And Welded Cones, Frame Stretches, Hinge Reinforcing Plates , Fixing Plates And Hardware Mounting Plates And Polyurethane Foam Infill B. ) Shutter Of Thickness 46Mm Made Of 0.8 Mm Thick Slip Coated Pre Galvanized Steel Sheet On Both Sides Conforming To Astma527 / Astma525, Bs29891994, Is277, Zinc Coating 120Gsm. Lock Formed Panels With Internal Stiffeners Of 3Mm Thick Made Of Galvanized Sheet, 3 Mm Thick Hinge Reinforcing Hardware Mounting Plates And Lock Protection With Honey-Comb Craft Paper Infill Of Thickness 150 Gsm Of Load Bearing Capacity 500 Kilogram / Squaremetre. C. ) Finish: Powder Coated Surfacefinished With Thermosetting Polyurethanepaintofaliphaticgradeofthickness60-Micrond. ) Accessories:Min8anchorfastenerof Hilti Make, Min 3 Ss Ball Bearing Butt Hinges Of Dorset Make, Dorset Cylindrical Lock, Ss Tower Bolt Of 200 Mm Size, Door Stopper Complete. 1489 Providing & Fixing Factory-Made Single Leaf 2 Hour Fire Rated Dooras Per Is 3614 Part 2 & Bs 476 Part 20 & 22, Tested To Ul 10 C And Conforming To Nfpa 80 , Tested At Ntl / Cbri / Arai Of Plain Steel Finish Type With A. ) Frame Of Size 143X58 Mm And Thickness Of 1.6 Mm Thick Skin Pass Galvanized Iron Sheet ( Conform To Is 277 ) Formed To Single Or Double Rebate Profile B. ) Shutter Of 46 Mm Thickness And Constructed From 1.2 Mm Thick Skin Pas Galvanized Iron Sheet ( Conform To Is 277 ) Infill Rockwool / Mineral Wool / Honey Comb Craft Paper C. ) Vision Glass Of 5Mm Thick Clear / Wired Glass Circular Or Rectangular D. ) Finish : Primed With Zinc Phosphate Stoving Primer And Finished With Polyurethane Aliphatic Grade Or Epoxy Paint As Required Of Thickness 60Microne. ) Accessories :Min8anchor Fastenerof Hilti Make, Min3ssball Bearing Butt Hinges, Mortise Sash Lock With Lever Handle, Mortise Dead Bolt , Mortise Latch , Door Closer And Flush Bolts Complete. 1490 Providing & Fixing Factory-Made Single Leaf 2 Hour Fire Rated Dooras Per Is 3614 Part 2 & Bs 476 Part 20 & 22, Tested To Ul 10 C And Conforming To Nfpa 80 , Tested At Ntl / Cbri / Arai Of Plain Steel Finish Type With A. ) Frame Of Size 143X58 Mm And Thickness Of 1.6 Mm Thick Skin Pass Galvanized Iron Sheet ( Conform To Is 277 ) Formed To Single Or Double Rebate Profile B. ) Shutter Of 46 Mm Thickness And Constructed From 1.2 Mm Thick Skin Pas Galvanized Iron Sheet ( Conform To Is 277 ) Infill Rockwool / Mineral Wool / Honey Comb Craft Paper C. ) Vision Glass Of 5Mm Thick Clear / Wired Glass Circular Or Rectangular D. ) Finish : Primed With Zinc Phosphate Stoving Primer And Finished With Polyurethane Aliphatic Grade Or Epoxy Paint As Required Of Thickness 60Microne. ) Accessories :Min8anchor Fastenerof Hilti Make, Min3ssball Bearing Butt Hinges, Mortise Sash Lock With Lever Handle, Mortise Dead Bolt , Mortise Latch , Door Closer , Panic Bar And External Trim Lock And Flush Bolts Complete. 1491 Providing&Fixing Factory-Made Aluminumwindowsofaluminum Alloyhe9wp ( 6063T5 / T6 ) , Powder Coating Of Jotun / Akzonobel Of 60 Micron Thickness A. ) Glass: 5Mm Thick Clear Float Of Saint Gobain / Asahi Make B. ) Mesh Of Ss Type 304 Grade Of .22 Mm Thickness C. ) Accessories: Epdm ( Ethylene Propylene Diene Monomer ) Gasket , Ss Screws , Aluminum Cleats , Roller , Push Handle , Fly Mesh Handle , Anti Lifter , Uguide Glass And Mesh Shutter Complete 1492 Providing & Fixing Factory-Made Steel Windows Constructed Of Skin Pass Galvanized Iron Sheet ( As Per Is 513?DQuality, Galvanized As Per Is 277 With Hot Zinc Coating Of 120 Grams / Sq.Mtr& Thickness Of 0.6 Mm ) With A. ) Window Shutter Of .6Mm Thick Skin Pass Galvanized Lron Sheet B. ) Window Frames Of .8M Thick Skin Pass Galvanized Iron Sheet Of Size 80Mm X 45Mm C. ) Mullion : Of 0.8Mmthick Skin Pass Galvanized Lron Sheet Of Size 80Mm X 60Mm D. ) Vision Glass Of 4Mm Clear Float Glass In Rectangular Shape. E. ) Finish : Coated With Zinc Phosphate Primer Or Thermosetting Polyurethane Paint Of Aliphatic Grade Providing High Levels Of Scratch Resistance And Durability F. ) Ms Grill Of 10 Mm Square Ms Bright Bars G. ) Accessories : Ss Pin Type Hinges—1 Set; Polypropylene , Handle—1, Friction Stay Powder Coated–1, Ms Powder Coated Tower Bolt—2 ( Ethyl Propylene Diamine Monomer ( Epdm ) Should Be Used All Around Glass In Shutter For Fixing Of Glass ) ; Corner Brackets — 4 ( Made Of Polypropylene Each Per Shutter And Frame ) Complete 1493 Providing, Aupplying, Fabricating And Fixing Panel Of Aluminium Composite Panel Cladding In Approved Shape Made Out Of 4 Mm Thick Acp Sheet Material Consisting Of 3Mm Thick Fr Grade Mineral Core Following Nbc Part Iv Fire And Life Safety ( Having 2 Hours Fire Resistance In Accordance To Astm E119-12 And Bs476 Part 6 And 7 Class O ) Sandwitched Between Two Aluminium Sheets ( Each 0.5 Mm Thick Of Aa 5005 / Aa3105 Grade ) The Aluminium Composite Panel Cladding Sheet Shall Be Coil Coatedwithkynar 500Basedpvdf / Lumiflon Based Fluropolymer Resin ( Having 70:30 Ratio Of Pvdf And Acrylic ) Coating Of Approved Colour And Sg=Hade On Top Face And Polymer ( Service ) Coating Of Bottom Face As Specified Using Stainless Steel Screws, Nuts, Bolts, Washers, Cleats, Weather Silicon Sealent, Backer Rods Etc .Overall Weight Of The Acp Shall Not Be Less Than 7.5 Kilogram / Square Metre ) 1494 Providing Internal Cement Plaster 25 Mm Thick In Single Coat Using Ready To Use Wall Plaster In Cement Mortar 1:4To Concrete, Brick, Stone Surfaces Inall Positions Including Scaffolding Andcuring. Providing Groove At Joint Of B.B. Masonry And Concrete Members Complete.With Prior Approval Of Concerned S E 1495 Providing Internal Cement Plaster 20Mm Thick Ina Single Coat Using Ready To Use Wall Plasterto Concrete, Brick Surfaces In All Positions Including Scaffolding And Curing. Providing Groove At Joint Of B.B.Masonry And Concrete Members Complete. ) Tti 1 5 With P Ial F C D S E 1496 Providing Internal Cement Plaster 20Mm Thick In A Single Coat Usingready To Use Wall Plasterto Concrete, Brick Surfaces In All Positions Including Scaffolding And Curing. Providing Groove At Joint Of B.B.Masonry And Concrete Members Complete.B ) Cement Mortar 1:4 With Prior Aproval Of Concerned S.E. 1497 Providing Internal Cement Plaster 20Mm Thick In A Single Coatusing Ready To Use Wall Plasterto Concrete, Brick Surfaces In All Positions Including Scaffolding And Curing. Providing Groove At Joint Of B.B.Masonry And Concrete Members Completec ) Cement Mortar 1:3 With Prior Approval Of Concerned S.E. 1498 Providinginternalcementplaster20mmthickinasinglecoatusingreadytousewallplaster Incement Mortar 1:3 To Stone Masonry Surfaces Inall Positions Including Scaffolding And Curing. Providing Groove At Joint Of Stone Masonry And Concrete Members Complete.With Prior Approval Of Concerned S E 1499 Providing Internal Cement Plaster 12 Mm Thick In A Single Coat Using Ready To Use Wall Plaster To Concrete Or Bricksurface Inallpositionsincluding Scaffolding Andcuring Complete.Providinggroove Atjointofb.B. Masonry And Concrete Members Complete.A ) Cement Ratio 1 5 With Prior Approval Of Concerned S E 1500 Providing Internal Cement Plaster 12 Mm Thick In A Single Coat Using Ready To Use Wall Plaster To Concrete Or Bricksurface Inallpositionsincluding Scaffolding Andcuring Complete.Providinggroove Atjointofb.B. Masonry And Concrete Members Complete.B ) Tti 1 4 With P Ial F C D S E 1501 Providing Internal Cement Plaster 12 Mm Thick In A Single Coat Using Ready To Use Wall Plaster To Concrete Or Bricksurface Inallpositionsincluding Scaffolding Andcuring Complete.Providinggroove Atjointofb.B. Masonry And Concrete Members Complete.C ) Cement Ratio 1:3 With Prior Approval Of Concerned S.E. 1502 Providing Internal Cement Plaster 6 Mm Thick In A Single Coat Using Ready To Use Wall Plaster In Cement Mortar 1:3Toconcretesurfaceinallpositionsincludingscaffoldingandcuring.Providinggrooveatjointof B.B.Masonry And Concrete Members Complete.With Prior Approval Of Concerned S.E. 1503 Providing Autoclaved Areated Concrete Block Masonry Of Approved Manufacture Confirming To Is 2185 Part Iii 1984 Of Size 600 Mm X 200Mm And Thickness 100, 150, 200 Or 250 Mm Using Ready To Use Block Joint Mortar1:6In Foundations And Plinth Of Inner Walls / External Walls Including Bailing Out Water, Striking Joints On Unexposed Faces, Racking Out Joints On Exposed Faces And Watering Complete..With Prior Approval Of Concerned S.E. 1504 Providing And Fixing 50Mm Diameter And 1.5 Mm Thick Stainless Steel Hand Railing In S.S.304 Grade Including Fabricating, Fixtures, Errecting, Necessarywelding, Grinding, Finishing, Buffingtostainlesssteelpipeetc.Complete 1505 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below A ) Up To 10 User Size ( 1.0Mx1.0Mx0.70M ) , Capacity Of Biodgester:-700 Liters, Area Of Top, Bottom And Side Walls:-4.80Sq.M, Areaofpartitionwalls:1.40Sq.M, Totalweightoffrp:-33.48Kilogram, Bacteria Inoculums Quantity: - 200 Liters , Minimum Thickness Of Side Walls / Top And Bottom: 3Mm, Number Of Insidepartitions- 3 Minimum Thickness Of Partition Wall: 3Mm 1506 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below B ) Up To 15 User Size ( 1.0Mx1.0Mx1.0M ) , Capacity Of Biodgester:-1000 Liters, Area Of Top, Bottom And Side Walls:-6Sq.M, Areaofpartitionwalls:2Sq.M, Totalweightoffrp:-54Kilogram, Bacteriainoculums Quantity: - 400 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 4Mm, Number Of Inside Partitions: -3Mini Thikftitill3 1507 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below C ) Up To 25 User Size ( 1.5Mx1.0Mx1.0M ) , Capacity Of Biodgester:-1500 Liters, Area Of Top, Bottom And Side Walls:-8Sq.M, Area Ofpartitionwalls:2Sq.M, Total Weightof Frp:- 82.80Kilogram, Bacteriainoculums Quantity: - 600 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 5Mm, Number Of Inside Partitions: -3Minimum Thickness Of Artition Wall: 3Mm 1508 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below D ) Up To 40 User Size ( 2.0Mx1.0Mx1.0M ) , Capacity Of Biodgester:-2000 Liters, Area Of Top, Bottom And Side Walls: - 10 Sq.M, Area Of Partition Walls: 3 Sq.M, Total Weight Of Frp: - 106.20 Kilogram, Bacteria Inoculums Quantity: - 600 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 5Mm, Number Of Inside Partitions: -3Minimum Thickness Of Artition Wall: 3Mm 1509 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below E ) Up To 60 User Size ( 2.4Mx1.25Mx1m ) , Capacity Of Biodigester:-3000 Liters, Area Of Top, Bottom And Side Walls:-13.30Sq.M, Areaofpartitionwalls:3.75Sq.M, Totalweightoffrp:-139.95Kilogram, Bacteria Inoculums Quantity: - 1000 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 5Mm, Number Of Insidepartitions: - 3Minimum Thickness Of Partition Wall: 3Mm 1510 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below F ) Upto80usersize ( 2.7Mx1.5Mx1m ) , Capacityof Biodigester:-4000Liters, Areaof Top, Bottom Andside Walls:-16.50Sq.M, Areaofpartitionwalls:4.50Sq.M, Totalweightoffrp:-202.50Kilogram, Bacteria Inoculums Quantity: - 1400 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 6Mm, Number Of Insidepartitions: - 4Minimum Thickness Of Partition Wall: 3Mm 1511 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below G ) Upto100usersize ( 2.5Mx2mx1m ) , Capacityofbiodigester:-5000Liters, Areaoftop, Bottom Andside Walls:-19.00Sq.M, Areaofpartitionwalls:8.00Sq.M, Totalweightoffrp:-248.40Kilogram, Bacteria Inoculums Quantity: - 1800 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 6Mm, Number Of Insidepartitions- 4Minimum Thickness Of Partition Wall: 3Mm 1512 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below H ) Up To 150 User Size ( 3.2Mx2.0Mx1.25M ) , Capacity Of Biodigester:-8000 Liters, Area Of Top, Bottom And Side Walls: - 25.80Sq.M, Area Of Partitionwalls: 10.00Sq.M, Total Weight Of Frp: - 397.08 Kilogram, Bacteria Inoculums Quantity: - 3200 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 7Mm, Number Of Insidepartitions- 4Minimum Thickness Of Partition Wall: 4Mm 1513 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below I ) Up To 200 User Size ( 4Mx2.0Mx1.25M ) , Capacity Of Biodigester:-10000 Liters, Area Of Top, Bottom And Side Walls: - 31.00Sq.M, Area Of Partitionwalls: 10.00Sq.M, Total Weight Of Frp: - 462.60 Kilogram, Bacteria Inoculums Quantity: - 3400 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 7Mm, Number Of Insidepartitions- 4Minimm Thickness Of Partitionall: 4Mm 1514 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below J ) Up To 300 User Size ( 4.8Mx2.0Mx1.25M ) , Capacity Of Biodigester:-12000 Liters, Area Of Top, Bottom And Sidewalls:-36.20Sq.M, Areaofpartitionwalls:10.00Sq.M, Totalweightoffrp:-593.28Kilogram, Bacteria Inoculums Quantity: - 4200 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 8Mm, Numberof Inside Artitions: - 4Minimum Thickness Of Artition Wall: 4Mm 1515 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below K ) Up To 400 User Size ( 5Mx2.0Mx1.5M ) , Capacity Of Biodigester:-15000 Liters, Area Of Top, Bottom And Side Walls: - 41.00Sq.M, Area Of Partitionwalls: 12.00Sq.M, Total Weight Of Frp: - 678.80 Kilogram, Bacteria Inoculums Quantity: - 5200 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 8Mm, Number Of Insidepartitions: - 4Minimum Thickness Of Partition Wall: 4Mm 1516 Providing And Installing Bio Digester Unit Based On Drdo Technology Made Of Fibre Reinforced Plastic ( Frp ) Having Composition And Following Technical Specifications And Including Necessary Pipe And Accessories Up To 3 Meter Length, Excluding The Necessary Excavation For Installing The Bio Digester.Percentage Of Fibre Glass ( Glass Content In Fibre Glass Should Be Minimum 30% ) : -33.33% Percentage Of Polyester Resin: - 66.67%Water Absorption ( As Per Astm ) :-0.30% Flammability As Per Astmtensile Strength:-115 Mpaspecific Gravity At 25 Degree Centigrade 1.45 Izod Impact Strength:-65Kj / M2heat Defection / Distort Temperature:-65Deg C Corrosion Resistance ( Non Corrosive ) Fitted With Inlet Pipe Size Rigid Pvc: -100Mmoutlet Pipe Size Rigid Pvc:-80Mmgas Outlet Rigid Pvc With Valve: 20Mmbacteria Immobilization Pvc Mattes ( On All Partition ) With Drdo Tot Licensee And Latest Batch Certificate ( Month & Year Of Supply ) And Capacity As Below L ) Up To 500 User Size ( 6Mx2.0Mx1.6M ) , Capacity Of Biodigester:-20000 Liters, Area Of Top, Bottom And Side Walls: - 50.72Sq.M, Area Of Partitionwalls: 13.36Sq.M, Total Weight Of Frp: - 917.86 Kilogram, Bacteria Inoculums Quantity: - 7000 Liters, Minimum Thickness Of Side Walls / Top And Bottom: 9 Mm, Number Of Inside Partitions: - 4, Minimum Thickness Of Partition Wall: 4Mm 1517 Providingandlayinghyperplasaluminiumorequivalentpolymericmultiplemonolithicfivelayerwater Proofing Flexible, Pliable And High Tensile Strength Membrane ( 3 Kilogram / Square Metre ) Which Is Comprise Of Top With V Shape Embossed 40 Micron Aluminium Foil To Bear Thermal Expansion And Avoiding Delamination &Consistofcentrecoreof90micronthickhighmolecularhighdensitypolyethylenefilm ( Hmhdpe ) Which Is Protected On Both The Side With Polymeric Mix. Applying The Membrane By Thermofusing To Roof & Parapet After Applying Thinfilm Of Hot Blownbitumen 85 / 25Or 90 / 15Grade @ 1.2 Kilogram / Square Metre Maximum As Per Surface Condition Or Hyperplas Primer @ 250 Gms / Square Metre As Per Site Condition On The Surface To Be Treated With 10 Cm Overlapping Including Finishing Etc. Complete And Covering Guarantee Of 7 Years On Stamp Paper Of Rs. 100 / - And As Directed By Engineer-In-Charge. ( Prior Permission Of S.E.In Writing Is Necessary Before Inclusion Of This Item In Estimate ) . 1518 Providingandlayinghyperplasstandardorequivalentpolymericmultiplemonolithicfivelayerwater Proofing Flexible, Pliable And High Tensile Strength Membrane ( 3 Kilogram / Square Metre ) & Consist Of Centre Core Of 90 Micron Thick High Molecular High Density Polyethylene Film ( Hmhdpe ) Which Is Protected On Both The Side With Polymeric Mix. Applying The Membrane By Thermofusing To Roof & Parapet After Applying Thin Film Of Hot Blown Bitumen 85 / 25 Or 90 / 15 Grade @ 1.2 Kilogram / Square Metre Maximum As Per Surface Condition Or Hyperplas Primer @ 250 Gms / Square Metre As Per Site Condition On The Surface To Be Treated With 10 Cm Overlapping Including Finishing Etc. Complete And Covering Guarantee Of 7 Years On Stamp Paper Of Rs. 100 / - And As Directed By Engineer-In-Charge. ( Prior Permission Of S.E.In Writing Is Necessary Before Inclusion Of This Item In Estimate ) . 1519 Providing And Laying Mechanical Protective Layer Over Water Proofing Membrane With Cement Screed Plaster 1:5 After Laying Chicken Mesh Over Membrane Including Curing Etc. Complete 20 Mm Thick With Cost Of Chicken Meshetc.Completeandcovering7yearsguaranteeoncourtstamppaperofrs.100 / -Includingnecessary Testing Specified By Engineer ( Prior Permission Of S.E. Is Necessary Before Inclusion Of This Item In Estimate ) ( Note :- This Item Shall Be Executed Over Item Number 5 Of Bd-J Water Proofing ) 1520 Providing And Applying A Silicon Base Water Repellent Stone Sealers, On Brick / Stone Masonry / Concretesurfacesintwocoatsbyspraying.Includingcleaning / Sandblastingfor Removingdirt / Cementmortar Patches Etc. By Force Water Jetwire Brushing Etc. Complete. 1521 Providing Internal / External12 Mm Thick Ready Mix Plaster Confirming To Is:4031 ( Part-4 ) 1988 And Is 383- 1970Ina Single Coat Using Cement Mortar Of Proportion1:4Containing Special Type Of Polymeradditives About 0.4%, To All Type Of Surfaces In All Positions Including Scaffolding And Curing Complete. 1522 Providing Internal / External 20 Mm Thick Ready Mix Plaster Confirming To Is:4031 ( Part-4 ) 1988 And Is 383- 1970Ina Single Coat Using Cement Mortar Of Proportion1:4Containing Special Type Of Polymeradditives About 0.4%, To All Type Of Surfaces In All Positions Including Scaffolding And Curing Complete 1523 Providing Brick Masonry With Interlock Fourlock Bricks In Retaining Walls , Diaphragm Wall , Compound Wall, Plinth & Partition Wall Etc Of Specified 150 Mm Thick Including Construction With InterlockFourlock Brick, Fillingthehollowspaceswithcementiousgroutmaterialofproportionofc:M1:6Usingtrapstonegrit Metal / Artificial Sand Dusting Off The Finished Brick MasonryFourlock Bricks, Surface, Watering & Curing Etc Complete. ( Including Steel Reinforcement Of 8Mm Bar As Strengthening Bar In Hollow Spaces Of Fourlock Bricks With Cementious Greet Material ) 1524 ProvidingbrickmasonrywithinterlockFourlockBricksinplinth&Superstructure Ofspecified150mm Thick Including Construction With Interlock Fourlock Bricks, Filling The Hollow Spaces With Cementious Grout Material Of Proportion Of C:M 1:6 Using Trap Stone Grit Metal / Artificial Sand Including Dusting Off The Finished Brick Masonry Surface, Watering & Curing Etc Complete. ( Excluding Steel Reinforecement For Strengthening ) 1525 Providing Brick Masonry With Interlock Fourlock Bricks In Retaining Walls , Diaphragm Wall , Compound Wall, Plinth & Partition Wall Etc Of Specified 100 Mm Thick Including Construction With InterlockFourlock Brick, Fillingthehollowspaceswithcementiousgroutmaterialofproportionofc:M1:6Usingtrapstonegrit Metal / Artificial Sand Dusting Off The Finished Brick MasonryFourlock Bricks, Surface, Watering & Curing Etc Complete. ( Including Steel Reinforcement Of 8Mm Bar As Strengthening Bar In Hollow Spaces Of Fourlock Bricks With Cementious Greet Material ) 1526 ProvidingbrickmasonrywithinterlockFourlockBricksinplinth&Superstructure Ofspecified100mm Thick Including Construction With Interlock Fourlock Bricks, Filling The Hollow Spaces With Cementious Grout Material Of Proportion Of C:M 1:6 Using Trap Stone Grit Metal / Artificial Sand Including Dusting Off The Finished Brick Masonry Surface, Watering & Curing Etc Complete. ( Excluding Steel Reinforecement For Strengthening ) 1527 Construction Of M-40 Grade Reinforced Prestressesd Precast Concrete Panel Of 200 Mm Thickness Having Size 4.5M X3.5M Or As Per Drawing, Casting The Panels As Per Approveddesignanddrawing Infactory Orplant Including Cost Of All Materials, Formwork, Reinforcement, Dowel Bars, Tie Bars, Chairs, Lifting Bolts, Grout Ports, Labour And All Necessary Machineries Which Are Required For Prestressing The Wires, Preparing Concrete Mix As Perjobmixdesign ( The Minimum Cementcontentform40grade Ofppcpshallbe440kilogram / Cumof Concrete ) , Making Slots In Panels For Fixing Dowel Bars, Tie Bars, And Placing Necessary Reinforcement As Per Design And Drawing, Steam / Curing For 28 Days Including Lifting, Transportating Andplacing The Panels At The Required Position, Line, Level And Alignment As Directed By Enginner In Charge, With Max 20% Fly Ash ( Fly- Ash Upto 20% By Weight Of Cement ) Over A Prepared Sub Base. Including Providing And Fixing In Position Ms Plain Dowel Bars Precoated With Anticorrosive Epoxy Paint Of Required Dia. Having 45 Cms. Length And At 30.00 Cm. C / C Lubricated For Half Length With Bituminous Paint And Providing & Fixing Tmt Fe 500 Tie Bars 12 Mm 1528 Providing Andlaying Of Plastiribtor Equivalent Raisedprofile Edge Line Marking ( Audible Vibratory ) With Special Hot Applied Thermoplastic Road Marking Compound According To Irc 35 : 2015, Clause 7.7 With2 Mm Thick Base Coat Layer Above That Ribs Profile Size Of Length 40 Mm X Width 140 Mm X Height 6Mm Thick ( Total 8 Mm Thick ) At The Distance Of 250 Mm Between Two Ribs Including Reflectorizing Glass Beads @ 250 Gm / Sq. Mtr. Area. The Minimum Andmaximum Widthof Raisedprofile Shouldbe 150Mm. The Thickness Of 8Mm Profilshouldbeexclusiveofsurfaceappliedglassbeads.Thefinishedsurfacetobeexclusiveofsurface Applied Glass Beads. The Finished Surface To Be Levelled, Uniform And Free From Streaks And Holes, To Be Applied On Edge Lines. 1529 Providing And Laying Of Plastirib 2K Or Equivalentraised Profile Edge Line Marking ( Audible Vibratory ) With Special 2 Component Cold Applied Road Marking Compound According To Irc 35 : 2015, Clause 7.7 With 2 Mm Thick Base Coat Layer Above That Ribs Profile Size Of Length 40 Mm X Width 140 Mm X Height 6Mm Thick ( Total 8 Mm Thick ) At The Distance Of 500 Mm Between Two Ribs Including Reflectorizing Glass Beads @ 250 Gm / Sq. Mtr. Area. The Minimum Andmaximum Widthof Raisedprofile Shouldbe 150Mm. The Thickness Of 8Mm Profilshouldbeexclusiveofsurfaceappliedglassbeads.Thefinishedsurfacetobeexclusiveofsurface Applied Glass Beads. The Finished Surface To Be Levelled, Uniform And Free From Streaks And Holes, To Be Applied On Edge Lines. 1530 Providing And Layingof Rumble Strips With Plastirib 2K, Or Equivalent 2 Component Cold Plasticprofiled Material To Give Total Width Of 500 Mm And Height Of 10 Mm. Ramp Providedto Give Width Of 145 Mm, Width Of Ribs To Be 55Mm Laid At Centre To Centre Distance Of 35 Mm, With Reflective Glass Beads @ 350 Gm / Square Metre.The Finished Surface To Be Levelled, Uniform And Free From Streaks And Holes, To Be Applied On The Edge Lines, Including Surface Cleaning And Cost Of All Materials Etc. Complete. 1531 Providing And Laying Of 2 Or More Sets ( 6 Nos. Each Set ) Dual Ribs Pattern Rumble Markings On Roads With Vehicular Speeds Of More Than 50 Km / Hr Laid As Per The Spacing Recommended For Each Set Under Table 11.1 And Fig. 11.2 Of Irc 35:2015 Using Plastirib 2K, Or Equivalent 2 Component Cold Plastic Profiled Material. Each Dual Rib Pattern Rumble Marking Shall Have Width Of 500 Mm. Each Dual Rib Pattern Rumble Marking Shall Have 2 Ribs Each Of Width Of 100 Mm And Height 20 Mm. Gap Between Two Ribs Shall Be 300 Mm. Each Rumble Marking Shall Be Made Complete With Drop On Soild Plus Reflective Glass Beads @ 300 Gm / Square Metre Spread Throughout The Surface Of Marking. The Finished Surface To Be Levelled, Uniform And Free From Streaks And Holes, Including Surface Cleaning And Cost Of All Materials Etc. Complete. 1532 Supplyingandfixing Ofplasticbodystuds Withtwoshanksandwithoutshanksofswareflexor Equivalent In Yellow, Red And White Color Made Of Abs Body With Size 100*100*17.9 Mm, Having Reflective Panels Of 34 Special Swaro Glass Reflective Elements Embedded In Plastic And 19 Degrees Tilted To Provide The Highest Reflectivity. Having Reflective Panels In Yellow, Red And White Plastic With Yellow, Red, White Or Green Swaro Glass Elements. The Studs Shall Have A Compressive Strengthtest Certificate Of 25Tons Inaccordance Withastdm D 4280 And Successfully Passing Retro Reflectivity Test As Per En 1463-1 And The Road Test En 1463-2 From A Reputed Laboratory. The Fixing Of The Road Studs Shall Be Done By Using A Recommended Two Component Epoxy. In Addition Two Holes Should Be Drilled In The Depth Of 50 Mm On The Road For The Version With Two Shanks. 1533 Supplying And Fixing Of Swareflex Or Equivalentmetal Road Studs With Shank, Made Of Die-Cast Aluminum Alloy Molded Body With The Size Of 100*100*19.8 Mm, Shank Size 50Mm, Having Reflective Panels Of 34 Glass Reflectiveelementsembeddedinplasticand19degreestiltedtoprovidethehighestreflectivityhaving Reflective Panels In Yellow, Red And White Plastic With Yellow, Red, White Or Green Glass Elements. The Weight Ofaluminumstudshouldbenotlessthan370grams.Thestudsshallhaveacompressivestrengthtest Certificate Of 40 Tons In Accordance With Astdm D 4280-04 And Successfully Passing Retro Reflectivity Test As Peren1463part1&Part2, Fromareputedinternationallaboratory.Thebiddershallattachaproduct Warrantycertificateagainstbreakageandlossofreflectivityfromthemanufacturerfor3yearsfrom Installation. The Fixing Of Roadstuds Shall Be Done By Using Arecommendedtwocomponent Epoxyafter Drilling 60 Mm Hole On The Road For The Shank To Go Inside. 1534 Supplying Andfixing Of Plastic Body Of Swaro Warnor Equivalent 184*81*60Mm, Mountedonroadside Plasticguidepostsataheightof 80Cmto100cmfromthegroundlevelandfixedonpostwithscrews Supplied With The Swaro Warn Product. Swaro Warn Comes In White Or Blue Color. Visual Wildlife Warning System Deflecting The Headlightsofapproaching Vehicle Towardsroadside Atduskornightforcreatinga Visual Warning Fence For The Wildlife To Avoid The Accidents Of Wild Life. Confirming Standards Rvs 04.03.12. The Swaro Warn Article 7178 Can Be Used For All Types Of Terrain. 1535 Soil Stabilisation-Stabilizationof In-Situ ( Existing Pavement Crust ) Or Soil Or Otherwise Sub-Base Course Upto Therequireddepthbycoldin-Siturecyclingusingchemicaladditives / Otherwise:Providing Pulverizing, Spreading, Milling And Mixing Of Chemical Additives At The Rate Of Minimum 750 Ml / Cum Require Quantity As Per Job Mix Design In Accordance With Irc37-2012.Cementitious Additive @ Rate Of Minimum 4% Shouldbespreadontheexistingpavementusingamobiletruckmountedcontainerizedcement / Additive Spreaderwithmicroprocessorcontrolledweighingandspreadingsystem.Theadditivespreadershallhave Variableworkingwidthsufficienttocoverwholepavementlane.Thein-Situstabilizationprocessshallbe Carried Out By A Mobile And Self Propelled Stabilizer / Reclaimer Of Working Width Of 2.4 Mt And With Minimum Engine Horse Power Of 440 Kw With A Variable Working Depth Of Minimum 50 Cm.The Resultant Stabilised Mix Then Would Be Profiled To The Required Grade , Level And Thickness Using Motor Grader And The Mix Would Be Compacted Using 20 Tonne Pad Foot Roller In Combination With Smooth Whell Roller To Achieve Desired Proctor Densityasperirc37-2012Andcompleteinallrespectsandcuringwithwaterasrequiredincludingall Materials , Labor And Machinery Etc.The Entire In-Situ Process Would Be Carried Out In Single Pass With Milling And Pulverzing Of Damaged Asphalt Pavement / Soil / Aggregates / Soil-Aggregate Mixture To The Desired Depth And With Simultaneous Addition Of Additives And Water With Machine Integrated Spray Bars Fitted On The Wheeled Self-Propelled Andvibratorypadfootrollertoachievedesiredproctordensityinallrespects.Necessary Gradedstoneaggregatesshallbeaddedtoachievedesiredprofileoftheroad.Theminimumunconfined Compresssive Strength ( Ucs ) Of Stabilized Sub Base Should Be 4.5 To 7 Mpa After 7 / 28 Days Curing As Per Irc37-2012 .Also , Durability Aspects ( Wet-Dry Cycles ) Of Stabilized Sub Base Should Be Satisfied As Per Irc37- 2012 .The Gradation Mixes And Magterials Should Be As Per Irc37-2012. 1536 Rehabilitation Of Existing Damaged Asphalt Pavement By, Cold, In-Situ, Recycling Process, Using Foam Bitumen As Binder And Cement As Filler, As Per Irc 120 2015 / Irc 37 2012.A Layer Of 20 Mm Fresh Aggregates To A Thickness Of 30 Mm, Or, As Per Design Mix, Would Be Pre-Spread Evenly, On The Existing Surface Using Paver / Motor Grader.1.00%Cementbyweightofmixshallbepre-Spreadonthelayeroffreshaggregatesusing Truckmounted Cement Spreader With Computer-Controlled Spreader System Of Width 2.40 Meters.Thefreshlylaidaggregates, Spreadedcement, And, Alayerofexistingdamagedpavementshallbethen Pulverised And Recycled In-Situ By Injecting 2% Bitumen ( Vg30 ) As Foam-Bitumen To Design Depth Using Self- Propelled 4 Wheeled, Cold Recycler Machine With Working Width Of 2.4 M Fitted With 440 Kw Engine.Themachineshallhavein-Builtbitumenheatingunitandduelspraybar, Forfoamingtheheatedbitumen ( Vg30 ) And Water Spray Bar. The Built-In Nozzles Shall Evenly Spray Both, Foamed Bitumen And Water During The Milling Process.Theresultantmixwouldthencompacttorequireddensitybyheavyroller, Profiledbygraderandfurther Compacted By Smooth Roller And Ptr. ( This Cold Recycled Surface Shall Be Then Covered With Tack Coat And Bituminous Concrete Of 50Mm Thickness, Cost Of Both To Be Accounted Separately ) 1537 Providinganderectingaroadrestraintsystem- Rollersystembarrieretirollersystemh1&H2 Comprisiong Of Post Of Hot Dip Galvanized Steel Of 139.8Mm Diameter ( L-2200And L-750 ) Thickness 4.5 Mm Spaced With Interval Of 1 Meter Installed In To Hardened Road . Safety Frame Rail From Sheet Of 3.20Mm Thick Are Fixedto Main Posts, Shock Absorbing Rollers 345Mm Diameter And 480Mm Height Made Of Polypropelene - Eva , Post Caps, Locker , Pipes And Connection Material. Distance Between Main Post And Short Post Shall Be 500 Mm. The Height Of Upper Edge Rail Is 960 Mm. All Steel Parts ( Frame S235r Equivalent Ss400 ) And Post S235jr Shall Be Hot Dip Galvanised To Protect Against Corrosion. The System Shall Be Installed In Accordance With The Drawings And Assembly Instructions. Etc. Complete. 1538 Providing And Laying Stone Matrix Asphalt With 100-120 Tph Batch Type Hot Mix Plant Producing An Average Output Of 75 Tonne Per Hour Using Crushed Aggregate Of Specified Grading Premixed With Bituminous Binder @5.80 Minimum Percent Of Mix And Filler, Transporting The Hot Mix Towards Site, Laying With Hydrostatic Paver Finisher With Sensor Control To Required Grade, Level And Alignment, Rolling With Smooth Wheeled, Vibratory And Tandemrollerstoachievethedesiredcompactionaspermorthspecificationclausenumber515etch. Complete In All Respects, Irc Sp 79 1539 Milling Of Existing Bituminous Surface To Specified Depth Of Bituminous Layer Including Disposal Of Removed Material With All Lift And Lead Upto 1000 M Etc Complete. Using Machine Like Writgen ( W100 ) Or Equivalent 1540 Providingandapplyinglowviscositybitumenemulsionrs1forsealingcrackslessthan3mmwideor Incipient Fretting Or Disintegration In An Existing Bituminous Surfacing. 1541 Providing Andlaying Microsurfacing Course Comprising Of Dry ( A ) Fine Aggreegates Confirming To Type Iii Grading@12Kilogram / Squaremetre.Ofroadsurfacecoverageofspecificationasperircsp81, 2008 Polymer / Latestmodifiedcationicquicksettingbitumenemulsionhaving60%Bindercontentand3.6% Polymer ( B ) @ 12.5% By Weight Of Fine Aggregate Ordinary Portland Cement ( C ) @ 2% By Weight Of Agrregate Chemical Additives ( D ) @1.5% By Weight Of Fine Aggregate And Water As Per Requirement. 1542 Providing And Laying A Stress Absorbing Membrane Interlayer ( Sami ) / Bitumen Impregnated Geotextile Layer After Cleaning The Road Surface, Geotextile Conforming To Requirements Of Clause 703.3, Laid Over A Tack Coat With1.05Kilogrampersquaremetreofpavinggradebitumen80-100Penetration / Emulsionasperrequirement And As Directed By Engineer In Charge 1543 Pot Hole Filling With Jet Patcher-Repairs To Potholes50 Mm Upto 100 Mm By Using Semidense Bituminous Concrete Incoldmixbyusingemulsionincludingmaking Thepotholes / Patchesinregularshape Andsize. Removingloosepockets, Dewateringinpotholes, Tackcoatsof25kilogram / 10Sq.Mt.Withrs1emulsion Etc.By Use Of Advancedjetpatching Technolgy Machine Of Approvedmake Andspecificationhaving Capacity5.50To8.00Cubicmeterswithauxillaryenginewithdirectdrivetoheavydutyblower, Rotarypositive Displacementblowerwithdirectdriveandseparateairlinesilencer. ( Capacity–15Psi, Flowrate 1370 / Cum / Hr ) . Cleaning As Directed By Engineer – In-Charge Etc. Complete ( Emulsion @ 5% By Weight Of Mix ) 1544 Open Graded Premix Surfacing- Providing And Laying Ogc 20 Mm Thickness Composed Of 13.2 Mm To 5.6 Mmaggregatespremixedwithbituminousbindertransportedtositewithvts, Laidoverapreviously Preparedsurface, Finishedtotherequiredgrade, Level, Alignment, Androllingtoachievethedesired Compaction But Excluding Prime / Tack And Seal Coat. For Bitumen Of Specified Grade--Using Batch Mix Type Hotmixplantwithscada, Paverandvibratoryroller ( Overbtsurface ) ( Vg-30Bulkbitumenratesare Considered To Arrive At Rates ) 1545 Open Graded Premix Surfacing- Providing And Laying Ogc 20 Mm Thickness Composed Of 13.2 Mm To 5.6 Mmaggregatespremixedwithbituminousbindertransportedtositewithvts, Laidoverapreviously Preparedsurface, Finishedtotherequiredgrade, Level, Alignment, Androllingtoachievethedesired Compactionbutexcluding Prime / Tack Andseal Coat.For Bitumenof Specifiedgrade--Usingbatch Mix Type Hot Mix Plant With Scada, Paver And Vibratory Roller ( Over Mpm Surface ) ( Vg-30 Bulk Bitumen Rates Are Considered To Arrive At Rates ) 1546 Chipping Of All Loose And Spalling Of Concrete To Bottom Of Slab, Beams Etc. ( Wherever Required ) , Cleaning Of Reinforcement, Carrying Outthoroughsandblasting, Applicationofanti-Corrosive Zincrichepoxyprimerto Exposed Reinforcement Including Cost Of Material, Labour, Equipment, Tools, Scaffolding Etc. Complete. 1547 Providing And Applying Epoxy Bonding Agent For Bonding Oldto Newconcrete For Structural Members Prior Applying The Epoxy Mortar To The Concrete Surfaces Etc Complete. 1548 Providingandapplyingepoxymortarofresinandhardnerwithsillicasandupto20mmthicknessof Sika / Fosroc / Pidilite Or Its Equivalent Including Proper Wire Brushing Etc Complete As Per The Direction Of Site-In-Charge 1549 Charges For Groove Cutting Of15 Mm X 15 Mm Deep Along Crack And Sealing And Refilling The Same With Epoxy Mortar Including Cost Of Material, Labour Etc. Complete 1550 Cleaning Of Rocker & Roller Bearing Using High Pressure Water Jet, Free From Rust Scales, Re-Setting & Greasing The Bearings Using Graphite Grease Including Cost Of Materials, Labour Etc., Complete. 1551 Bearing Cleaning And Pier Cap Cleaning For The Proper Movement Of Bearing Etc. Complete Including All Tools And Machineries Scaffolding Etc. Complete As Per The Direction Of Site In Charge. 1552 Providing And Applying?Highstrength, Non Shrink Free Flow Groutmaterial?I. E. Micro Concrete ( Like Shrink Comp Or Equivalent ) Having Compressive Strength As 400 Kilogram / Sq.Cm. Including Finishing The Surface And Curing For 07 Days. Etc Complete. The Usage Of This Non Shrink Concrete With Zero Slump Is To Allow To Occupy Every Free Space Leaving No Voids, Thereby Producing Dense Concrete With Proper Bonding With Concrete ( The Quoted Rates To Beinclusive Of All Materials, Labours, Tools & Tackles, Transportation, Taxes Etc Complete ) To Be Applied For Foundation And Strengthening Of Pier Etc And As Per The Direction Of Site-In-Charge. ( The Product Like Ultratech / Rendroc ( Rgl ) Of Fosroc Or Its Equivalent ) 1553 Providingapplyingpolymermodifiedcementmortarpointingtothestonemassonrystructureincludingchipping, Cleaning, Applying Bonding Agent, Stagging, Curing Andand All Tools And Tackes Including Safety Etc. Complete 1554 Grouting To The Dowel Bars With Epoxy Of Resin+Hardner To Ensure The Proper Fixing Of Dowel Bars Including All The Machineries Etc. Complete, As Per The Direction Of Site- In-Charge. 1555 Providingandapplyingwaterfroofcoatingtotheconcretesurfacetoresistentryofmoistureandprevent Growth Of Fungus Etc. Complete As Per The Direction Of Site In Charge. 1556 Liftingofspanandbearinglocationsby Suitablehydraulic Jacks Connected By High Pressure, Rubber Hoses To Pump & Removalof Old Exsting Bearing ( Roller Side Only ) As Per Quotation 1557 Strengthening Structuralelementsby Providing&Fixingcarbonfiber ( Makesikaorbasfor Fosroc ) Surface Preparation: Grinding Concrete Substrate, Cleaning It With Wire Brush Removing Oil, Laitance If Present, Rounding Sharp Edges To Min 25 Mm Radius Etc. Complete.Profiling:Providing&Applyingcompatiblembraceprimeronpreparedsubstrate, Fillingtheholesand Uneven Surface Withhigh Strength Epoxy Putty Etc. Complete If Required.Wrapping: Providing & Applying First Coat Of Saturant, Cutting The Carbon Fiber Sheet To Size, Wrapping The Fiber Sheet To Structural Element At Desired Orientation Using Tamping Roller To Avoid Any Air Voids Etc. Complete. Sand Pasting: Providing & Applying Second Coat Ofsaturant After Min. 12 Hrs, Rectify Air Voids If Any Paste The Rive Sand On It To Make Surface Rough To Take Any Further Finishes ( Modeofmeasurement:Persq.Mtofmbracecf400sheetappliedandnotsurfaceareaofconcrete Application&Quantitywillbemeasuredincludingwastage ) Therate Includesalltypeof Material, Application, Equipment & Scaffolding Etc Complete. Rate Is Applicable For All Height & Level. 1558 Replacement Of Existing Damaged Expansion Joints By Providing And Laying Of Strip Seal Expansion Joint System, Including Removal Of Existing Damaged Exp Joints By Dismantling Of Deck Slab, Wearing Coat Etc. And Back Filling Of The Recess Up To Final Finish Level With Conc Of Grade M-35, Complete As Per M.O.R. T&H Specification. 1559 Providing Polymer Modifiedcement Mortar Treatment After Removing Of Existing, Clading, Plaster, Gunite & Cleaning And Preparing The Surface.Applying Polymer Cement Bond Coat And Polymer Modified Cement Mortar Aspermanufacturerspecificationupto50mm Thickwith8%Polymerbyweightofcementtofilltheallcavities & Making Protective Cover Plaster Including Shuttering 1560 Providing, Drilling And Fixing Nipples For Pressure Injection Grouting Of Polymer Cement Grout Etc. Complete 1561 Filling Voids / Honeycomb With High Pressure Injection Grouting Of Polymer Cement Grout ( 10% Of Polymer By Weight Of Cement ) 1562 Providing And Laying In Situ / Ready Mix M35 Grade Rcc Jacketing Work Around The Existing Piers Of Bridges Etc.Complete. ( Withfullyautomaticmicroprocessorbasedplcwithscadaenabledconcrete Batchmix Plant / Pan Mixer With Fine Agreegates Of Required Specifications ( Vsi Sand Finely Washed Etc ) , Height Of 8 To10 Meter ) 1563 A ) Precast Beb Panals1 Providing And Fixing Precast M 25 Grade Concrete Curved Section Of 100 Mm Thick To Serve As Bandhara As Perthestandarddrawingapprovedbydepartmenthavingellipticalshapewithbaseupto6maspertable Attatched To Be Casted In Factory In Suitable Sections And Transporting To Site And Erecting The Same Including All Leads, Lifts, Labour And Machinaries With Finishing .Number Of Elements In Which Compled Section Is Proposed To Be Cast Shall Be Approved.Necessary Equipments For Placing Giving Support Through Turnbucle Or Similar Arrangement To Maintain Its Verticality Till Insitu Joining..The Total Steel Quantity Is 75Kilogram Per Cubic Meter Ofconcretethemethodstatementshallbepreparedandgotapprovedfromengineerincludingcostof Plasticizer And Viscocity Admixure. 1564 B ) Hot Dip Galvanised Needle Gate1 Manufacturing With Oap & Fabrication Of Hot Dip Galvanisedneedle Gates - Curved Type Of Required Size Andweightasperthedetaileddesignanddrawingswithallmaterial, Mildsteelconfirmingtois2062, Rubber Seal Confirming To Is 4623 & Welding Electrodes Aws E6013 For General Weld Joints. It Includes All Materials, Labourcharges, Machinerycharges, 1Kmleadchargesoftransportation, Loadingandunloading Charges Of Gate Parts At Site, Inspection & Quality Control Charges, Sand Blasting, Overhead Charges Of 10%, And All Incidential Charges Including All Duties, Taxes, Levies And Insurance Charges Excludung Gst 1565 Providing And Fabricating And Fixing At Site Hot Dipgalavanised Structural Steel Work In Rolled Sections Like Joists, Channels, Angles, Teesetc.Asperdetaileddesignanddrawingsorasdirectedincludingcutting, Fabricating, Hoisting, Erecting, Fixinginpositionmakingrivetediboltediweldedconnectionswithout Connecting Plates, Braces Etc. Complete Including All Transporation , Labour And All Lift Excluding Gst 1566 C ) Frp Needle Gate1 Providing , Supplying And Fixing Of Frp Gates -Needlesin Curved Or Straight Shape In Size Required Size And 60Mmthickforthebridge-Cum-Bandhara.Thegate / Needlesshouldwithstandunderminimumwater Pressure Of 7.00 Tonne. With Interlocking Arrangements, Required Rubber Seals To Arrest Water Leakage Due To Surface Unevenness Including Frp C Channels At Both Side Of Gate Of Size 100 Mm X 100 Mm With 10 Mm Thick, With Lifting Eye Bolts. And As Per Specifications Mentioned In The Technical Spectications And Product Features Excluding Gst 1567 Providing And Fixing Sill Beam In Size 100 X100 Mm With 10 Mm Thick, In Frp Material With Lifting Eye Bolts. And As Per Specifications Mentioned In The Technical Spectications And Product Features Excluding Gst 1568 Supply And Installation Of Cubicles Of Width And Depth As Per Athena Lite- Ss Series Cubicles- Std Sizes ( W X D X H ) : 900 Mm X 1550 Mm X 2105 Mm, ( Height Is Including 100 Mm Gap From Bottom, Door Width- 600 Mmspecifications / Sitedrawings ) .Cubicleheighttobe2105mm.Madefromsolidgradecompacthigh Pressurelaminateasperis:2046Anden-438Manufacturedunderhighspecificpressure>5Mpaand Temperature >120°C, All Doors Will Be Of Single Colour And Made Of 12 Mm Thick Merino Hpl Compact Panel. The Doors Will Have Chamfered Edges. Each Door Will Be Supported By 3 Stainless Steel Made Hinges Affixed To The Pilasters. Size Of Panels To Be As Per Drawing. Hardware & Accessories Are H Shaped ( Top ) Head Framestructuremadeofextrudedaluminiumgrade6063t5-50Micronepoxypowdercoatedforsurface Protection, Size To Be 125X70x5t.Corner Joinery Section, Size To Be 40X16.5X1.8T. U-Channel Wall Joinery Section, Size To Be 22X16x1.6T. Door Stopper Section, Size To Be 21X12.5X1.6T.Spring Loaded Butt Hinges Made From Stainless Steel Grade 304. Surface Finish To Be Matt Type. Covers To Be Lacor Coated.Etc Complete. 1569 Supply And Installation Ofceiling Hungcubicles Of Width And Depth As Per Specifications / Site Drawings. Cubicle Height To Be 2400 Mm. Std Sizes ( W X D X H ) : 900 Mm X 1550 Mm X 2400 Mm, ( Height Is Including 100 Mm Gap From Bottom ) Door Width- 600 Mmitem Description Made From Solid Grade Merino Make Compact High Pressure Laminate As Per Is:2046 And En 438 Manufactured Under High Specific Pressure > 5 Mpaandtemperature >120° C, All Doorswill Be Of Single Colour Andmade Of18mm Thick Merinohpl Compact Panel. The Doors Will Have Chamfered Edges. Each Door Will Be Supported By 3 Stainless Steel Made Hinges Affixedto The Pilasters. All Intermediate Partitions Or Dividers Will Be Made Of 12Mm Thick Merino Hpl Compact Laminate Panels. Size Of Panels To Be As Per Drawing. Hardware & Accessories Are H Shaped ( Top ) Headframestructuremadeofextrudedaluminumgrade6063t5-50Micronepoxypowder Coatedforsurfaceprotection.Sizetobe 125X70x5t. Cornerjoinerysection, Sizetobe40x16.5X1.8T.U- Channel Wall Joinery Section, Size To Be 22X16x1.6T. Door Stopper Section, Size To Be 21X12.5X1.6T. Spring Loaded Butt Hinges Made From Stainless Steel Grade 304. Surface Finish To Be Matt Type. Covers To Be Lacor Coated.Coat Hook With Rubber Stopper Made From Stainless Steel Grade 304. Surface Finish To Be Matt Type. Etc Complete. 1570 Supply And Installation Ofpd Door Cubicles Of Width And Depth As Per Specifications / Site Drawings. Pd Door Height To Be 1980 / 2100 Mm.Pd Doors Series :Std Sizes ( W X H ) : 2100 Mm X 7500 Mm ( Height Is Including150mmgapfrombottom ) , Doormadefromsolidgrademerinomakecompacthighpressure Laminate As Per Is:2046 Manufactured Under High Specific Pressure > 5 Mpa And Temperature >120°C , .Panel Thickness12mm.Sizeofpanelstobeasperdrawing.Hardware&Accessoriesarespecially Designedd-Shape Wall Mountedpole Made From Extrudedgrade Aluminum Alloy 6063 / He9 / T-6 Andepoxy Powder Coated ( Color As Per Specifications ) For Surface Protection. Size To Be 46X41x2t, Matching Profile And Color Nylon Polyamide-6 Caps To Cover Aluminum Poles, Self Closing Hinges ( Gravity Mechanism ) Made From Nylonpolyamide Grade-6. Color To Be As Per Specifications, Stainless Steel Grade 304 Screws, Anti-Rotation Nylon Polyamide Grade-6 Expandable Wall Plugs, Etc Complete. 1571 Supply And Installation Of12mm Box Up Cubicles Of Width And Depth As Per Specifications / Site Drawings. Cubicle Height To Be 2100Titan Box Up 18 Mm Series Cubicles:Std Sizes ( W X D X H ) - 900 Mm X 1550 Mm X 2100 Mm, ( Height Is Including 100 Mm Gap From Bottom ) Door Size- 600 Mm Mm.Titan Box Up 18 Mm Series Cubicles:Std Sizes ( W X D X H ) - 900 Mm X 1550 Mm X 2100 Mm, ( Height Is Including 100 Mm Gap From Bottom ) Door Size- 600 Mmtitan Box Up 18 Mm Series Cubicles:Std Sizes ( W X D X H ) - 900 Mm X 1550Mmx2100mm, ( Heightisincluding100mmgapfrombottom ) Doorsize-600Mmitem Description:Madefromsolidgrademerinomakecompacthighpressurelaminateasperis:2046 Manufacturedunderhighspecificpressure>5Mpaandtemperature>120°C, Alldoorswillbeofsingle Colourandmadeof18mm Thickmerinohplcompactpanel.Allpilasterswillbemade Of18mm Thick Merino Hpl Compact Panel. Hardware & Accessories Are No Head Frame Structure, All Panels To Be Aliengned To The Top, Corner Joinery Section Made From Stainless Steel Grade 304. Surface Finish To Be Brush Type. A Thin Plastic Film Pasted For Surface Protection. Size To Be 35Mmx15mmx0.8 Mm. Etc Complete. 1572 Supply Andinstallationof Cubicles Of Widthanddepthas Per Specifications / Site Drawings. Cubicle Height Will Be 1980 Mmtitan Std Series Cubicles:Std Sizes ( W X D X H ) : 900 Mm X 1550 Mm X 1980 Mm / 2039 Mm ( Height Is Including 150 Mm Gap From Bottom ) Door Size- 600 Mm When Top Rail Of Rectangular Cross Section Is Used And 2039 Mm When Top Rail Of Circular Cross Section Is Useditem Descriptionmade From Solidgrade Merinomake Compacthighpressure Laminate Asperis:2046Anden-438Manufacturedunder High Specific Pressure > 5 Mpa And Temperature >120°C, All Doors Will Be Of Single Colour And Made Of 12 Mm Thick Merino Hpl Compact Panel. All Pilasters Will Be Made Of 12 Mm Thick Hpl Compact Panel. Size Of Panels To Be As Per Drawing. Hardware & Accessories Are Top Rail Is Made Ofstainless Steel Grade304.Therearetwooptionsforthetoprail.Firstonecomeswitharectangularcrosssection ( Sizetobe 55Mmx42mmx1.6Mmt ) Andtheotheronecomeswithcircularcrosssection ( Diameter32mm ) .Surface Finish To Be Brush Type. A Thinplastic Film Pasted For Surface Protection. Corner Joinery Section Made From Stainless Steel Grade 304. Surface Finishto Be Brushtype. Athin Plastic Film Pastedfor Surface Protection. Size To Be 35Mmx15mmx0.8 Mm. Etc Complete. 1573 Supplyandinstallationofzms ( Nylon ) Cubiclesofwidthanddepthasperspecifications / Sitedrawings. Cubicle Height Will Be 2003 Mm. Zms Series Cubicles:Std Sizes ( W X D X H ) : 900 Mm X 1550 Mm X 2003 Mm, ( Height Is Including 150 Mm Gap From Bottom ) Door Width- 600 Mmitem Descriptionmade From Solidgradecompacthighpressurelaminateasperis:2046Anden-438Manufacturedunderhighspecific Pressure > 5 Mpa And Temperature >120°C. All Doors Will Be Of Single Colour And Made Of 12 Mm Thick Hpl Compact Panel. All Pilasters Will Be Made Of 12 Mm Thick Hpl Compact Panel. All Intermediate Partitions Or Dividers Will Be Made Of 12Mm Thick Hplcompact Laminate Panels. Size Of Panelsto Be As Perdrawing. Hardware & Accessories Are Semi-Spherical ( Top ) Head Frame Structure For Surface Protection. Size To Be 50X32x1.6T. Corner Joinery Section, Size To Be 40X16.5X1.8T.U-Channel Wall Joinery Section, Size To Be 22X16x1.6T.Door Stopper Section, Size To Be 21X12.5X1.6T. Stainless Steel Grade 304 Screws, Anti-Rotation Nylon Polyamide Grade-6 Expandable Wall Plugs, The Work Shall Complete As Per Drawing , Under Supervision Of Engineer In Charge, Etc Complete. 1574 Steel Fiber Reinforcement:Supplying, Providing And Mixing Hooked End / Crimped Steel Fibers With Aspect Ratio Between 50 To 80 ( Diameter Between 0.45 To 01Mm Andlength Between 12.5 To 60Mm ) Manufactured From Cold Drawn Wire And Having A Minimum Tensile Strength Of 1100N / Sq.Mm, As Per Ce Certification Label Mark, He Non-Glued / He Glued, Non-Balling, Conforming To Astm A 820 / En 14889-1, Compatible With All Construction Chemicals Used For The Batching, Laying And Curing Of Concrete. The Fibers Shall Be Added To The Concrete Atspecifieddosage Andshallbe Mixedwiththeconcrete Ingredientsforsufficienttime Toensure Uniformdistributionandpumpingconcrete.Additionofsteelfibersincementconcreteforflooring / Pavement / Ccroads ( Allgroundsupportedslab ) / Undergroundstructure / Precastitems ( Likedrains, Manhole Covers, Walls, Paverblocks, Pipes, Tunnelsegments ) Etc.Dosesasperapproveddesignsanddirectionsof Engineer-In-Charge.Hsn Code For Steel Fibres Is 73170013.Regularly Used Are Mscf 50; Msh 10050; Msh 7560; Msh7035; Msh 6035; Msh 5530; Nsh-G 7560; Msh-G 7035; Msh-G 6035; Msh-G 5530Etc. Are Some Of The Widely Used Sizes. 1575 Fire Door 55Mm 2Hr Frl ( 120 / 120 ) 3 Criteria - Integrity / Insulation / Stability Woodendoor - Fire Door Tested In Accordance To Is: 3614 Part 2. Providing Of 120Minfire Rated Doors System Duly Tested For 3 Criteria - Integrity, Insulation Andstability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 At National Test House, Govt Of India Laborator And / Or Withcentralbuildingresearchinstitute, Govtofindiaundertakingwithstandardheatingconditionsas Specified In Is:3614 Part Ii 1992 And Bs: 476 Part 20 & 22 1987 To Achieve The Required Integrity, Insulation And Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise On The Non Fire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Non Combustible By Nature ) . A ) Door Frame: Supplying & Fixingframes For Fire Resistant Door Shutters 1Stclass Malaysianhardwood Frame Densified ( 810 Kilogram / Cum ) And Pressure Treated With Fireretardant Chemicals In Vacuum Impregnationvesselunder160psipressure Asperis:401Andkilnseasonedtomoisture Below15%Asper Is:1141 Of Section 120 X 70 Mm Spray Quoted With 2 Coats Of Intumescent Paint Of Minimum 200Micron, With Single Row Of Brush- Type Astroflame Intumescent Strip Of Size 10Mm X 4Mm Affixed In The Slit Of The Frame For Fire And Smoke Sealing, Etc. Complete. 1576 Fire Door 55Mm 2Hr Frl ( 120 / 120 ) 3 Criteria - Integrity / Insulation / Stability Woodendoor - Fire Door Tested In Accordance To Is: 3614 Part 2. Providing Of 120Minfire Rated Doors System Duly Tested For 3 Criteria - Integrity, Insulation Andstability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 At National Test House, Govt Of India Laborator And / Or Withcentralbuildingresearchinstitute, Govtofindiaundertakingwithstandardheatingconditionsas Specified In Is:3614 Part Ii 1992 And Bs: 476 Part 20 & 22 1987 To Achieve The Required Integrity, Insulation And Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise On The Non Fire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Non Combustible By Nature ) . B ) Shutter : Supplying & Fixing Of 55Mm Thick Asbestos Free Criteria Checked - Fire, Heat And Smoke Resistant Composite Fire Check Door Shutter Complying With With Fire Performance - Fd 120 As Per Is:3614 ( Part - Ii ) Comprisingof2x8mmcalciumsilicateboardsoverchemicallytreated ( Withfireretardantchemicalsin Vaccum Pressure Impregnationvesselsunder160psipressure Asperis:401Andkilnseasonedtomoisture Below 15% As Per Is:1141 ) Internal Timber ( Malaysianhard Wood, Densified To 810 Kilogram / Cum ) Frame Work Of 100X32 Mm With 32Mm Thick Infill Of Ceramic Fiber ( Density 128 Kilogram / Cum ) , Vermaculite Mix Faced With 3Mm Fire Retardant High Density Fibre Board, Internally Lipped With Hardwood Beading And Pasted In Hydraulic Press Under 25 Mpa, Spray Quoted With 2 Coats Of In-Tumescent Paint Of Minimum 300 Micron, And With Single Row Of Brush- Type Intumescent Strip Of Size 10Mmx4mm Affixed On Periphery For Fire And Smoke Sealing In The Slit On All Edges Of Shutter Except Bottom, Without Any External Lipping. 1577 Fire Door 55Mm 2Hr Frl ( 120 / 120 ) 3 Criteria - Integrity / Insulation / Stability Woodendoor - Fire Door Tested In Accordance To Is: 3614 Part 2. Providing Of 120Minfire Rated Doors System Duly Tested For 3 Criteria - Integrity, Insulation Andstability Criteria As Per The Is: 3614 Part 2 And Bs: 476 Part 22 At National Test House, Govt Of India Laborator And / Or Withcentralbuildingresearchinstitute, Govtofindiaundertakingwithstandardheatingconditionsas Specified In Is:3614 Part Ii 1992 And Bs: 476 Part 20 & 22 1987 To Achieve The Required Integrity, Insulation And Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise On The Non Fire Side To The Maximum Of 140° C Above The Ambient Temperature On The Exposed Surface Of The Shutter. The Fire Doors Are Tested Withncbn Technology ( Non Combustible By Nature ) . C ) Vision Panel:2 Hr Rated E Class Clear High Stress Fire Rated Glass Is Pre Fabricated Strategically Inside The Shutter Structure With 10 Mm Inside The Shutter On All Sides With U- Glazing. An Additional Insulated Powdercoated Z Channel Of 16 Swg Ms Sheet To Be Fixed For Reinforcement Of The Joints. 1578 Providing Of2 Hour Rated Acoustic Fire Door To Effectively Control Noise In Conference Rooms, Broadcasting Studios, Theatresandmusicpracticerooms.Dulytestedfor3criteria- Integrity, Insulationandstability Criteriaaspertheis:3614Part2andbs:476Part22withstandardheatingconditionsasspecifiedin Is:3614 Part Ii 1992 And Bs: 476 Part 20 & 22 1987 To Achieve The Required Integrity, Insulation And Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise On The Non Fire Side To The Maximum Of 140° C Above The Ambient Temperature Onthe Exposedsurface Of The Shutter. The Accoustic Fire Doors Are Testedwithncbn Technology ( Non Combustible By Nature ) Duly Tested For Sound Insulation As Per Iso 10140-2 / Astm E 90 For Sound Transmission Loss Evaluation Of 42Db In Reverberation Chamber At Arai. A ) Doorframe:Providing&Fixingframesforfireresistantdoorshutters1stclassmalaysianhardwood Frame Densified And Pressure Treated With Fire Retardant Chemicals In Vacuum Impregnation Vessel Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below 15% As Per Is:1141 Of Section 120 X 70 Mm Sprayquotedwith2coatsofintumescentpaintofminimum200micron, With1rowof Brush-Type Astroflame® Intumescent Strip ( Imported ) Of Size 10Mmx4mm Concealed In The Groove Of The Frame For Fire And Smoke Sealing, Etc. Complete As Per Direction Of Engineer In Charge 1579 Providing Of2 Hour Rated Acoustic Fire Door To Effectively Control Noise In Conference Rooms, Broadcasting Studios, Theatresandmusicpracticerooms.Dulytestedfor3criteria- Integrity, Insulationandstability Criteriaaspertheis:3614Part2andbs:476Part22withstandardheatingconditionsasspecifiedin Is:3614 Part Ii 1992 And Bs: 476 Part 20 & 22 1987 To Achieve The Required Integrity, Insulation And Stability ( I.E. To Restrict The Heat Radiation, Temperature Rise On The Non Fire Side To The Maximum Of 140° C Above The Ambient Temperature Onthe Exposedsurface Of The Shutter. The Accoustic Fire Doors Are Testedwithncbn Technology ( Non Combustible By Nature ) Duly Tested For Sound Insulation As Per Iso 10140-2 / Astm E 90 For Sound Transmission Loss Evaluation Of 42Db In Reverberation Chamber At Arai. B ) Shutter:Supplying&Fixingof75mmthickasbestosfree, Fire, Heatandsmokeresistantcomposite Acoustic Door Shutter Complying With With Fire Performance - Fd 120 As Per Is:3614 ( Part - Ii ) Comprising Of 2X12mm Calcium Silicate Boards Over Chemically Treated ( With Fire Retardant Chemicals In Vaccum Pressure Impregnation Vessels Under 160 Psi Pressure As Per Is:401 And Kiln Seasoned To Moisture Below 15% As Per Is:1141 ) Internal Timber ( Malaysian Hard Wood, Densified To 810 Kilogram / Cum ) Frame Work Of 100X36 Mm With 36Mm Thick Infill Of Ceramic Fiber ( Density 128 Kilogram / Cum ) , Vermaculite Mix Faced With 6Mm Fire Retardanthighdensityfibreply, Internallylippedwithhardwoodbeadingandpastedinhydraulicpress Under 25 Mpa, Spray Quoted With 2 Coats Of In-Tumescent Paint Of Minimum 300 Micron, And With Single Row Of Brush- Type Intumescent Strip Of Size 10Mmx4mm Affixed On Periphery For Fire And Smoke Sealing In The Slit On All Edges Of Shutter Except Bottom And Placement Of 3 Mm Thick Rubber Membrane, At The Inside Face, Sandwitchedbetweencalcium Silicate Board& Highdensity Fire Retardant Ply, Without Any External Lipping With Triple Rebatting In Shutters, Etc Complete. Providing Offire Barrier Systems To Prevent The Spread Of Fire And Smoke Within Roof And Ceiling Voids. 1580 Fire Barrier:Providing 100Mm Thick Asbestos Free Composite - 3 Criteria - Fire, Heat And Smoke Check Fire Barrier To Prevent The Spread Of Fire And Smoke Within Roof And Ceiling Voids With Flame Guard Of 120 Minutes As Per Is: 3614 Part -Ii Comprising Of4x12mm Thickcalcium Silicate Boards, Chemicaltreatedinternaltimber Withfire Retardant Chemicals In Pressure Impregnation Vessels Under 160 Psi Pressure As Per Is:401And Kiln Seasoned To Moisture Below15% As Per Is:1141Frame Work Of 50Mm X 100Mm With50mm Thick Infill Of Ceramic Fiber ( Density 96Kilograms / Cmt ) , Vermaculite Mix Reinforced By Ms 8Mm Bars Supported Within The Existing Structure & Sealed With Fire Retardant Poly Urethane Foam. All Empty Spaces Will Be Filled With Ceremic Wool As Per Instruction Of The Engineer. 1581 Panic Bar: ( For 2 Hr Fire Rated Single Panic Bar ) Supplying, Fitting & Fixing Surface Mounted Crash Bar / Panic Bar Of Touch Pad Style , Made Of Heavy Duty Cast Iron / Steel Body & Latches With Ss , Bhma Certified & Conforming To Ansi A 156.3 For Grade-1 ( 3 Hours Fire Rated ) And Suitable For Surface Mounting To Wooden / Hollow Metal / Al Framed Door, With Maximum Operating Force 8Kilogram For Unlocking Easily & Outwardly During Emergency, Complete In All Respect As Per Direction & Satisfaction Of Engineer-In Charge Including All Taxes & Incidental Charges. ( Note: To Be Installed At Fire ExitOnly Under Location Specific Instruction Of Eingineer-In -Charge. ) 1582 Door Closure: ( For 2 Hr Fire Rated En-3 Door Closure ) Supplying, Fitting & Fixing Surface Mounted Overhead Door Closer For 2 Hour Fire Rated Doors Of Different Size ( E.G Size -En-3 For Leaf Width Upto 900Mm ) Ce Certified, Marked & Conforming Toen - 1154 Of Approved Quality ( Internationally Reputed Brand Like Dorma, Geze, Hafele, Assabloy & Magnum Etc. ) Fitted And Fixed Complete As Per Direction & Satisfaction Of Engineer -In Charge Including All Taxes & Incidental Charges. 1583 12Ss Handle: ( For 2 Hr Fire Rated 12Ss Handle ) Supplying, Fitting & Fixing Stainless Steel D Or H Type Of Size 300 Mm X 19 Mm Tubular Handle With Grade 304, Ce Certified, Marked & Conforming Toen - 1154 Of Approved Quality ( Internationally Reputed Brand Like Dorma, Geze, Hafele, Assabloy&Magnumetc. ) Asperdirectionofeingineer-Incharge Fittedandfixed Complete Including All Taxes & Incidental Charges. 1584 White Topping On Concrete Overlay For Urban Roadconstruction Of Thin White Topping Plain Cement Concrete Pavement Over A Prepared Sub Base With 43 Grade Cement, Coarse And Fine Aggregate Conforming To Is 383, Maximum Size Of Coarse Aggregate Not Exceeding 25 Mm, Replacing Cement By Fly Ash To The Extent Of 15 Per Centand Sand By 10 Per Cent, Mixed In A Batching And Mixing Plant As Per Approved Mix Design, Transported To Site, Laid With A Fixed Form Or Slip Form Paver, Spread, Compactedandfinishedinacontinuousoperationincludingprovisionofcontraction, Constructionand Longitudinaljointswithpanelsizeof1m X1m, Jointfiller, Sealantprimer, Jointsealant, Debondingstrip, Dowelbar, Tierod, Admixtures, Polypropylenefiberasapproved, Curingcompound, Finishingtolinesand Grades As Per Drawing 1585 Standard Metal Delineatorsupplyandinstallationofroaddelienators ( Roadwaydelienators ) Aspermort&Hclause806.The Structure Shall Be Manufactured In Roll Forming Process And Shall Have Height Not Less Than 800 Mm Above The Ground, Width Not Less Than 100 Mm And Shall Extend Not More Than 300Mm Below The Ground While Being Installed In Confirmation With Irc:79 1981Or As Directed By Engineer In Charge.The Delineator Shall Be Painted With Powder Coat Of Minimum 40 Microns Thickness For Protection Against Corrosion, On Top Of Which Type Xi Retro Reflective Sheeting Shall Be Pasted On Both Sides.The Delienator Shall Consist Minimum Retro Reflective Unitexposedareaof330cm2whitecolor, Fullcubecornermicroprismaticnon-Metallicretroreflective Sheeting On Each Side Conforming With Irc 67 2012 And Meeting The Coefficient Of Retro Reflection Values As Per Astm D 4956 Type Xi Table Specification.The Front And Back Faces Of The Delineator Should Be Curved With A Radius Of Not More Than 200 Mm And With Delta Angle ( Or Central Angle Of Curve ) Lying Between 20O And 30O, To Increase The Visibility Of The Delineator For Vehicles Moving In Continuous Curves. The Delineator Shall Have Grooves Across The Length To Make The Reflective Sheets Vandal-Proof. 1586 Flexible Median Markersupply And Fixing Of Flexible Median Marker Which Shall Be Made Of Tough, High Impact Resistant, Injection- Molded, Thermoplastic Body With U Shape Structure With Overall Height Of Minimum 180Mm And Shank Depth Of Minimum 30Mm And Thickness Not Less Than 2Mm. The Exposed Body Structure Should Be Cornered Rounded Forbetteraesthetics.Theplasticsusedforthemoldingtheflexiblemedianmarkershallhaveaminimum Notchedizodimpactstrengthvalueof 4.11J / Cm ( @Thickness3.17Mm ) Atroomtemperature, Testedin Accordance With Astm D256. The Outer Part Of The Body Shall Have The Abrasion Loss Not Less Than 35 Mm3 When Tested Accordance With Din53505 And Din53516 Respectively And Shall Retain At Least 70% Of This Value When It Is Subjected To Accelerated Weathering For 500Hrs As Per The Astm G155 Standard. . The Logo Of The Manufacturer Shall Be Embossedoneither Side Of The Body Inthe Injectionmolding Process. - The Flexible Median Marker Shall Have U Shaped Florescent Yellow Color Retro-Reflective Sheeting With Minimum Exposed Reflective Area 285 Mm2.The Reflective Sheeting Should Confirm To Type Xi Florescent Yellow Sheeting As Per Irc 67 2012 And Astm D4956-11. The Product Design Has To With Stand All Natural Impacts And Should Not Get Damaged If Any Pedestrian Stamp On Top Of It Intentionally Or Unintentionally. The Product Should Bend Up To 90 Degree On Both Sides ( Becoming Completely Horizontal ) , It Should Be Able To Take Minimum 200 Stamping Withoutanysignificantdamage.Theflexiblemedianmarkershallbefixedbyacombinationofepoxy Adhesive And Grouting / Drilling As Per Engineer In Charge 1587 Bitumnous Concrete :- Providing And Laying Bituminous Concrete Using Crushed Stone Aggregates Of Specified Grading, Premixed With Hima Grade Bituminous Binder Like Art ( Highly Modified Asphalt Binder Having Not Less Than 90°C Softening Point And Not Less Than 90% Elastic Recovery ) @ 5.4% ( Percentage By Weight Of Total Mix ) And Lime Filler @ 2% ( Percentage By Weight Of Aggregate ) Prepeared In Batch Type Hot Mix Plant And Filler, Transporting The Hot Mix To Work Site By Tippers, Laying With Paver Finisher Equiped With Electronic Sensor To The Required Grade, Level And Alignment And Rolling With Smooth Wheeled, Vibratory And Tandemrollerstoachievethedesired40 / 50Mmcompactedthicknessanddensityasperspecification, Complete And As Per Directions Of Engineer-In-Charge. 1588 Providing, Supplying, Laying & Fixing Of Concrete Canvas 5Mm Thick ( Flexible Concrete Impregnated Fabirc Which Hardens When Hydrated To Form Thin, Durble, Water Proof & Fire Resitant Concrete Layer Within 24 Hrs ) For Slope Protection / Drain Lining / Concrete Repair Works And Other Similar Works Complete In All Respect And As Per Direction Of Engineer-In-Charge. Special Condition 1 ) Contractor Shall Submit All Relevant Test Certificates Of The Material. 2 ) Mass Of Unset Concrete Canvas Should Be 7Kilogram / Square Metre. 3 ) Width Of Roll Should Be 1 M. 1589 Providing, Supplying, Laying & Fixing Of Concrete Canvas 8Mm Thick ( Flexible Concrete Impregnated Fabirc Which Hardens When Hydrated To Form Thin, Durble, Water Proof & Fire Resitant Concrete Layer Within 24Hrs ) For Slop Protecion / Drain Lining / Concrete Repair Works And Other Similar Works Complete In All Respect And As Per Direction Of Engineer-In-Charge. Special Condition1 ) Contractor Shall Submit All Relevant Test Certificates Of The Material. 2 ) Mass Of Unset Concrete Canvas Should Be 12Kilogram / Square Metre. 3 ) Width Of Roll Should Be 1.1M. 1590 Providing, Supplying, Laying & Fixing Of Concrete Canvas 13Mm Thick ( Flexible Concrete Impregnated Fabirc Which Hardens When Hydrated To Form Thin, Durble, Water Proof & Fire Resitant Concrete Layer Within 24Hrs ) For Slopw Protecion / Drain Lining / Concrete Repair Works And Other Similar Works Complete In All Respect And As Per Direction Of Engineer-In-Charge. Special Condition1 ) Contractor Shall Submit All Relevant Test Certificates Of The Material. 2 ) Mass Of Unset Concrete Canvas Should Be 19Kilogram / Square Metre. 3 ) Width Of Roll Should Be 1.1M. 1591 Providing, Supplying, Laying & Fixing Of Concrete Canvas Hydro 5Mm Thick ( Flexible Concrete Impregnated Fabirc Whichhardens Whenhydratedto Form Thin, Durble, Water Proof & Fire Resitant Concrete Layerwithin 24Hrs ) For Slopw Protecion / Drain Lining / Concrete Repair Works And Other Similar Works Complete In All Respect Andasperdirectionofengineer-In-Charge.Specialcondition1 ) Contractorshallsubmitallrelevanttest Certificates Of The Material. 2 ) Mass Of Unset Concrete Canvas Should Be 8Kilogram / Square Metre. 3 ) Width Of Roll Should Be 1M. 1592 Providing, Supplying, Laying & Fixing Of Concrete Canvas Hydro 8Mm Thick ( Flexible Concrete Impregnated Fabirc Whichhardens Whenhydratedto Form Thin, Durble, Water Proof & Fire Resitant Concrete Layerwithin 24Hrs ) For Slopw Protecion / Drain Lining / Concrete Repair Works And Other Similar Works Complete In All Respect Andasperdirectionofengineer-In-Charge.Specialcondition1 ) Contractorshallsubmitallrelevanttest Certificates Of The Material. 2 ) Mass Of Unset Concrete Canvas Should Be 13Kilogram / Square Metre. 3 ) Width Of Roll Should Be 1M. 1593 Supplyandinstallationoftranslucentroofwithdpifluxstandingseammulticellpolycarbonatepanel System. The System With Complete Assembly Of Co Extruded Uv Protected Multicell Panels Incorporated Into A Completesystem.Co-Extrudeduvprotectedpolycarbonatepanelsystemofmin12mm Thickof900mm ( Min. ) Width With Angular Daylighting Concept. Panels Shall Have Minimum Six Layers With Truss Bridge Design For Higher Flexibility & Strength. Panels With All Fixing Accessories To Ensure Best Performance For Wind Uplift, Vibration, Oil Canning And Visual Appearance. Panels Shall Be Manufactured With Vertical Standing Seam At Both Sides Of The Panel. Panels Shall Be Fixed On Purlin With Snap On Connectors With Double Tooth Grip Lock Locking Mechanism And Will Be Secured On Ms Structure ( Will Be Paid Separately ) With 3 Numbers Self-Drilling Screws & Trapezoid Ss Fasteners Holding The Base Of The Standing Seam Offering Best Stability Having A Pull-Out Load Of Min. 7000N ( 7Kn ) Tested As Per Iso 6892:1998 And Is 1608: 2005, As Per Design Requirement. Panels Must Satisfydartdropimpacttestasperis14443-97Shallshownosignofbreakageonpolycarbonatesheets Whichhavebeenexposedtouvforamin.Of500hoursasperastmg155.Panelsshallnothave Yellowness Index As Per Astm D 1925 Of 15 Units When Tested On A Sample Exposed To Uv For 500 Hours As Per Astm G 155. U Value Shall Not Be More Than 1.6 W / M2k As Per En Iso 10077-2:2018. Panel Shall Be With Additional End Cap / Aluminium U / F Profile / Glazing Bar For Ends As Required. Panel Shall Be Fixed Over Msstructuralsteel / Mspurlin ( Paidseparately ) Conformingtothedetailtechnicalspecificationsasper Approvedarchitecturaldrawings.Trainedandfactoryauthorizedlabourwithsupervisiontocompletethe Entire Panel Installation As Per Drawing & Directionof The Engineering Incharge. Colour: As Per Approval. Approved Make: Flux By Dpi Daylighting Or Approved Equivalent The 12Mm Thick Panels Shall Be Used For A Roofing Height Of Upto 15 Mtrs. 1594 Supply And Installation Of Dpi Flux Translucent Roof With Standing Seam Multicell Polycarbonate Panel System. Thesystemwithcompleteassemblyofcoextrudeduvprotectedmulticellpanelsincorporatedintoa Completesystem.Co-Extrudeduvprotectedpolycarbonatepanelsystemofmin16mm Thickof1200mm ( Min. ) Widthwithangulardaylightingconcept.Panelsshallhaveminimumsevenlayersinatrussbridge Design For Higher Flexibility & Strength. Panels With Opaque And Translucent Clear Combination As Per Required Luxlevelanddesignrequirementswithallfixingaccessoriestoensurebestperformanceforwinduplift, Vibration, Oil Canning And Visual Appearance. Panels Shall Have An Additional Ir Blocking Features For Enhance Thermal Comfort. Panels Shall Be Manufactured With Vertical Standing Seam At Both Sides Of The Panel. Panels Shall Be Fixed On Purlin With Snap On Connectors With Double Tooth Grip Lock Locking Mechanism And Will Be Securedonmsstructure ( Willbepaidseparately ) With3numbersself-Drillingscrews&Trapezoidss Fasteners Holding The Base Of The Standing Seam Offering Best Stability Having A Pull-Out Load Of Min. 7000N ( 7Kn ) Tested As Per Iso 6892:1998 And Is 1608: 2005, As Per Design Requirement. Panels Must Satisfy Dart Drop Impact Test As Per Is 14443-97 Shall Show No Sign Of Breakage On Polycarbonate Sheets Which Have Been Exposed To Uv For A Min. Of 500 Hours As Per Astm G 155. Panels Shall Not Have Yellowness Index As Per Astm D 1925 Of 15 Units When Tested On A Sample Exposed To Uv For 500 Hours As Per Astm G 155. U Value Shall Not Be More Than 1.9 W / M2k As Per En Iso 10077-2:2018. Panel Shall Be With Additional End Cap / Aluminiumu / Fprofile / Glazingbarforendsasrequired.Panelshallbefixedovermsstructural Steel / Ms Purlin ( Paid Separately ) Conforming To The Detail Technical Specifications As Per Approved Architectural Drawings. Trained And Factory Authorized Labour With Supervisionto Complete The Entire Panel Installation As Per Drawing & Direction Of The Engineer In Charge. Colour: As Per Approval The 16Mm Thick Panels Shall Be Used For A Roofing Height Of Upto 15 Mtrs. 1595 Supply And Installation Of Dpi Flux Translucent Roof With Standing Seam Multicell Polycarbonate Panel System. Thesystemwithcompleteassemblyofcoextrudeduvprotectedmulticellpanelsincorporatedintoa Completesystem.Co-Extrudeduvprotectedpolycarbonatepanelsystemofmin18mm Thickof1200mm ( Min. ) Widthwithangulardaylightingconcept.Panelsshallhaveminimumsevenlayersinatrussbridge Design For Higher Flexibility & Strength. Panels With Opaque And Translucent Clear Combination As Per Required Luxlevelanddesignrequirementswithallfixingaccessoriestoensurebestperformanceforwinduplift, Vibration, Oil Canning And Visual Appearance. Panels Shall Have An Additional Ir Blocking Features For Enhance Thermal Comfort. Panels Shall Be Manufactured With Vertical Standing Seam At Both Sides Of The Panel. Panels Shall Be Fixed On Purlin With Snap On Connectors With Double Tooth Grip Lock Locking Mechanism And Will Be Secured On Ms Structure ( Will Be Paid Separately ) With A Continuous Aluminium I Beam Holding The Base Of The Standing Seam Along The Length Of The Panel & Fixed With Purlin With Self-Drilling Hex Head Screws Offering Best Stability With A Pull-Out Load Of Min. 21000N ( 21Kn ) Tested As Per Iso 6892:1998 And Is 1608: 2005., As Per Design Requirement. Panels Must Satisfy Dart Drop Impact Test As Per Is 14443-97 Shall Show No Sign Of Breakage On Polycarbonate Sheets Which Have Been Exposed To Uv For A Min. Of 500 Hours As Per Astm G155.Panelsshallnothaveyellownessindexasperastmd1925of15unitswhentestedonasample Exposed To Uv For 500 Hours As Per Astm G 155. U Value Shall Not Be More Than 1.9 W / M2k As Per En Iso 10077-2:2018.Panelshallbewithadditionalendcap / Aluminiumu / Fprofile / Glazingbarforendsas Required. Panel Shall Be Fixed Over Ms Structural Steel / Ms Purlin ( Paid Separately ) Conforming To The Detail Technical Specifications As Per Approvedarchitectural Drawings. Trainedand Factory Authorized Labour With Supervisiontocompletetheentirepanelinstallationasperdrawing&Directionoftheengineerincharge. Colour: As Per Approval. The 18Mm Thick Panels Shall Be Used For A Roofing Height Of Upto 25 Mtrs 1596 Supply And Installation Of Dpi Flux Translucent Roof With Standing Seam Multicell Polycarbonate Panel System. Thesystemwithcompleteassemblyofcoextrudeduvprotectedmulticellpanelsincorporatedintoa Completesystem.Co-Extrudeduvprotectedpolycarbonatepanelsystemofmin22mm Thickof1200mm ( Min. ) Widthwithangulardaylightingconcept.Panelsshallhaveminimumsevenlayersinatrussbridge Design For Higher Flexibility & Strength. Panels With Opaque And Translucent Clear Combination As Per Required Luxlevelanddesignrequirementswithallfixingaccessoriestoensurebestperformanceforwinduplift, Vibration, Oil Canning And Visual Appearance. Panels Shall Have An Additional Ir Blocking Features For Enhance Thermal Comfort. Panels Shall Be Manufactured With Vertical Standing Seam At Both Sides Of The Panel. Panels Shall Be Fixed On Purlin With Snap On Connectors With Double Tooth Grip Lock Locking Mechanism And Will Be Secured On Ms Structure ( Will Be Paid Separately ) With A Continuous Aluminium I Beam Holding The Base Of The Standing Seam Along The Length Of The Panel & Fixed With Purlin With Self-Drilling Hex Head Screws Offering Best Stability With A Pull-Out Load Of Min. 21000N ( 21Kn ) Tested As Per Iso 6892:1998 And Is 1608: 2005., As Per Design Requirement. Panels Must Satisfy Dart Drop Impact Test As Per Is 14443-97 Shall Show No Sign Of Breakage On Polycarbonate Sheets Which Have Been Exposed To Uv For A Min. Of 500 Hours As Per Astm G155.Panelsshallnothaveyellownessindexasperastmd1925of15unitswhentestedonasample Exposed To Uv For 500 Hours As Per Astm G 155. U Value Shall Not Be More Than 1.9 W / M2k As Per En Iso 10077-2:2018.Panelshallbewithadditionalendcap / Aluminiumu / Fprofile / Glazingbarforendsas Required. Panel Shall Be Fixed Over Ms Structural Steel / Ms Purlin ( Paid Separately ) Conforming To The Detail Technical Specifications As Per Approvedarchitectural Drawings. Trainedand Factory Authorized Labour With Supervisiontocompletetheentirepanelinstallationasperdrawing&Directionoftheengineerincharge. Colour: As Per Approval The 22Mm Thick Panels Shall Be Used For A Roofing Height Of Upto 55 Mtrs. 1597 Providing And Applying Two Coats Of Hues Surface Coatings Clear Coat ( Stone-X ) With Silicon Technology On Stones, Clay Tiles, Bricks, Facades, Sand Stone, Plastered, Texture Finished Interior Or Exterior Surfaces. ( It Is Tested With Standand Test Method Numberis15489:2004 & Low Voc As Per Astm D2369 / Iso 11890-1 And Water Vapour Permeability As Per Astm D-1653 / Iso 7783 ) .Surfacepreparation Includes Cleaning And Scrubbing With Brush, Soap And Water To Remove All Dust, Fungus, Cement, Paints Etc, Washing With Water All Complete.The Coating Thickness And The Methodology Of Application Shall Strictly As Per ManufacturerS Specifitions And As Approved By Engineer In Charge.The Contractor Shall Give Guarantee For The Performanceof Coating For Water Repellency And Alsothe Durabitity Of Coating, All Complete As Per Direction Of Engineer - In- Incharge. 1598 Providing And Fixing Processed Stone Cladding On Wall Surface / Plywood Surface. Rcc Pardi / Wall And All Typeofinterior, Exterior Compoundwallandgateetc.Ofcladdingprocessedstonewithmaterialof Processed Clay, Wooden Chips, Silica Sand, Cement, Gfrc Admixtures, Colour Pigments, Fiber Up To Thick Of 230 Mm / 25 Mmincluding Scaffolding, Fixing Of Screw, Etc. ( As Directed By Engineer In Charge ) 1599 Frp Beam Crash Barrier -- Type - A, W : Frp Beam Crash Barrier ( Providing And Erecting A W Frp Beam Crash Barrier Comprising Of 3 Mm Thick Corrugated Sheet Frp Beam Rail, 70 Cm Above Road / Ground Level, Fixed On Ismc Series Channel Vertical Post, 150 X 75 X 5 Mm Spaced 2 M Centre To Centre, 1.8 M High, 1.1 M Below Ground / Road Level, All Steel Parts And Fitments To Be Galvanised By Hot Dip Process, All Fittings To Conform To Is:14856 ( 2000 ) And Is:18319 ( 2015 ) , Frp Beam Rail To Be Fixed On The Vertical Post With A Spacer Of Channel Section 150 X 75 X 5 Mm, 330 Mm Long Complete As Per Clause 810 ) As Directed By Engineer Incharge. 1600 Frp Beam Crash Barrier -- Type - B, Thrie : Frp Beam Crash Barrier ( Providing And Erecting A Thrie Frp Beam Crash Barrier Comprising Of 3 Mm Thick Corrugated Sheet Frp Beam Rail, 85 Cm Above Road / Ground Level, Fixed On Ismc Series Channel Vertical Post, 150 X 75 X 5 Mm Spaced 2 M Centre To Centre, 2 M High With1.15M Belowgroundlevel, Allsteelpartsandfitmentstobe Galvanisedbyhotdipprocess, Allfittingsto Conform To Is:14856 ( 2000 ) And Is:18319 ( 2015 ) , Frp Beam Rail To Be Fixed On The Vertical Post With A Space Of Channel Section150x75x5mm, 546Mm Long Complete Asper Clause 810 ) Asdirectedbyengineerih 1601 Providing And Fixing In Position Various Capacity Rainwater Harvesting Dual Intensity Auto Flush Open Ended At Drainoutletfilterwithworkingprincipalofcohessiveandcentrifugalforcehavingfilter Elementmadeoutofs.S.304Screenwithmeshsizeof205micronshavingrainfallcapacityof75m / Hr Intensity With Operating Pressure Of 0.060Kilogramper Sq.Cm. Of Head With Discharge Capacity Ranging From 10To 480Lit / Minincluding All Necessary Accessories Like Coupler, Bends, Pvc Valve, Etc Fixing Withbombay Nails Of Required Length Etc. Complete With Inlet Size Of 90 Mm To 110 Mm Diameter From Rooftop Pipe With Drainoutlet Of 90Mm To 110Mm Diameter Size Withcleanwater Outlet Of 62Mm To 90Mm Diameter Size Including Fitting And Fixing Excluding Inlet And Outlet Piping Etc Complete As Per The Direction By Engineer In Charge. Fl-100For The Catchment Upto 110Sq.M. System Size 90Mm Diameter Inlet, 63Mm Diameter Cleanwater Outlet, 90 Mm Diameter Drain Outlet ( Filterain, Tee, Door Bend, Valve 63Mm ) 1602 Providing And Fixing In Position Various Capacity Rainwater Harvesting Dual Intensity Auto Flush Open Ended At Drainoutletfilterwithworkingprincipalofcohessiveandcentrifugalforcehavingfilter Elementmadeoutofs.S.304Screenwithmeshsizeof205micronshavingrainfallcapacityof75m / Hr Intensity With Operating Pressure Of 0.060Kilogramper Sq.Cm. Of Head With Discharge Capacity Ranging From 10To 480Lit / Minincluding All Necessary Accessories Like Coupler, Bends, Pvc Valve, Etc Fixing Withbombay Nails Of Required Length Etc. Complete With Inlet Size Of 90 Mm To 110 Mm Diameter From Rooftop Pipe With Drainoutlet Of 90Mm To 110Mm Diameter Size Withcleanwater Outlet Of 62Mm To 90Mm Diameter Size Including Fitting And Fixing Excluding Inlet And Outlet Piping Etc Complete As Per The Direction By Engineer In Charge. Fl-150For The Catchment Upto 150Sq.M. System Size 90Mm Diameter Inlet, 75Mm Diameter Cleanwater Outlet, 90 Mm Diameter Drain Outlet ( Filterain, Tee, Door Bend, Valve 63Mm ) 1603 Providing And Fixing In Position Various Capacity Rainwater Harvesting Dual Intensity Auto Flush Open Ended At Drainoutletfilterwithworkingprincipalofcohessiveandcentrifugalforcehavingfilter Elementmadeoutofs.S.304Screenwithmeshsizeof205micronshavingrainfallcapacityof75m / Hr Intensity With Operating Pressure Of 0.060Kilogramper Sq.Cm. Of Head With Discharge Capacity Ranging From 10To 480Lit / Minincluding All Necessary Accessories Like Coupler, Bends, Pvc Valve, Etc Fixing Withbombay Nails Of Required Length Etc. Complete With Inlet Size Of 90 Mm To 110 Mm Diameter From Rooftop Pipe With Drainoutlet Of 90Mm To 110Mm Diameter Size Withcleanwater Outlet Of 62Mm To 90Mm Diameter Size Including Fitting And Fixing Excluding Inlet And Outlet Piping Etc Complete As Per The Direction By Engineer In Charge. Fl-200 For The Catchment Up To 225 Sq.M. System Size 110 Mm Diameter Inlet, 75 Mm Diameter Clean Water Outlet, 90 Mm Diameter Drain Outlet ( Filterain, Tee, Door Bend, Valve 75Mm ) 1604 Providing And Fixing In Position Various Capacity Rainwater Harvesting Dual Intensity Auto Flush Open Ended At Drainoutletfilterwithworkingprincipalofcohessiveandcentrifugalforcehavingfilter Elementmadeoutofs.S.304Screenwithmeshsizeof205micronshavingrainfallcapacityof75m / Hr Intensity With Operating Pressure Of 0.060Kilogramper Sq.Cm. Of Head With Discharge Capacity Ranging From 10To 480Lit / Minincluding All Necessary Accessories Like Coupler, Bends, Pvc Valve, Etc Fixing Withbombay Nails Of Required Length Etc. Complete With Inlet Size Of 90 Mm To 110 Mm Diameter From Rooftop Pipe With Drainoutlet Of 90Mm To 110Mm Diameter Size Withcleanwater Outlet Of 62Mm To 90Mm Diameter Size Including Fitting And Fixing Excluding Inlet And Outlet Piping Etc Complete As Per The Direction By Engineer In Charge. Fl-300 For The Catchment Up To 350 Sq.M. System Size 110 Mm Diameter Inlet, 90 Mm Diameter Clean Water Outlet, 90 Mm Diameter Drain Outlet ( Filterain, Tee, Door Bend, Valve 90Mm ) 1605 Providing And Fixing In Position Various Capacity Rainwater Harvesting Dual Intensity Auto Flush Open Ended At Drainoutletfilterwithworkingprincipalofcohessiveandcentrifugalforcehavingfilter Elementmadeoutofs.S.304Screenwithmeshsizeof205micronshavingrainfallcapacityof75m / Hr Intensity With Operating Pressure Of 0.060Kilogramper Sq.Cm. Of Head With Discharge Capacity Ranging From 10To 480Lit / Minincluding All Necessary Accessories Like Coupler, Bends, Pvc Valve, Etc Fixing Withbombay Nails Of Required Length Etc. Complete With Inlet Size Of 90 Mm To 110 Mm Diameter From Rooftop Pipe With Drainoutlet Of 90Mm To 110Mm Diameter Size Withcleanwater Outlet Of 62Mm To 90Mm Diameter Size Including Fitting And Fixing Excluding Inlet And Outlet Piping Etc Complete As Per The Direction By Engineer In Charge. Fl-500 For The Catchment Up To 500 Sq.M. System Size 110 Mm Diameter Inlet, 90 Mm Diameter Clean Water Outlet, 110 Mm Diameter Drain Outlet ( Filterain, Tee, Door Bend, Valve 90Mm ) 1606 To Carry Out Linear Drone Survey Agencies Will Use Fully Autonomous Professional Survey Grade Drone And In Post Process For Aerial Triangulation Required Ground Control Points And Benchmarks Will Be Collected By Using Surveygrade Dualfrequencydgps-Ppksystem.Afterpostprocessing Agencywilldeliverfollowingfinal Output.1.Geotagged Images In Jpg Format With Resolution Of 4-5Cm / Pixelwith70% Overlap2.Gcp Values In .Csv Format.3.3D Point Cloud Cover In .Las Format.4.Digital Surface Model ( Dsm ) In .Tiff Format.5.2D Orthorectified Images In .T Iff Format With 5 Cm Resolution Whichgives Capability To Capture Detailed Features. 1607 To Carry Out Polygondrone Survey Agencies Will Use Fully Autonomous Professional Survey Grade Drone And Inpost Process For Aerial Triangulationrequiredgroundcontrol Points Andbenchmarks Will Be Collectedby Using Survey Grade Dual Frequency Dgps-Ppk System. After Post Processing Agency Will Deliver Following Final Output.1.Geotagged Images In Jpg Format With Resolution Of 4-5Cm / Pixelwith70% Overlap2.Gcp Values In .Csv Format.3.3D Point Cloud Cover In .Las Format.4.Digital Surface Model ( Dsm ) In .Tiff Format.5.2D Orthorectified Images In .T Iff Format With 5 Cm Resolution Whichgives Capability To Capture Detailed Features. 1608 Scanning, Digitisationandgeo-Referencingofcadastral / Revenuemapsandinterpretationof Allexisting Featureslikebuilding, Waterbodies, Rivers, Agriculturalfield Etctogeneratebasemap.Creationofgis Platform By Using Orthorectified Image And Revenue Data By Linking Of Textual Data ( 7 / 12 ) Which Special Data ( Vector Digitised Maps ) . All Will Helps Toanalyse And Identify All Affected Properties. 1609 False Ceiling System Gi Metal Bioguard Clip In Plain Tile With Carrier System 600 X 600Mmproviding&Fixinghorizontallevelsuspendedceilingcomprisingofgibioguardclip-Inplaintile 600X600mm ( Nominal Size ) Tiles Of 120 Gsm Galvanized Steel As Per Is 277 ( 2003 ) Suitable For Architectural Finishes In 0.5Mm Thickness As Per In Is:513 ( 1994 ) In Global White Color With Concealed Suspension System Having A Bevelled Edge Of 3X3mm And Height Of 33Mm On One Side And 18Mm On The Other Side. Tiles Shall Be Flattened By Precision Leveller To Minimize Sag To Less Than 1 / 400Mm. The Tiles Shall Have Double Round Pip Of ?2Mmand?6Mmforsecureengagementandlevellingrespectively, Alongwithswingdownfeatureand Special Tabs To Allow Removal Of Tile To Enable Plenum Access. The Coated Surface Of The Tile Shall Exhibit Anti- Microbialproperties ( Eradicationandinhibitionofgrowth ) Andshallachieveupto99.99%Reductionin Bacterialactivityasperiso22196:2011.Thetileshallbeelectrostaticallypolyesterpowdercoatedusing Rohscompliantpowderhavingcoatingthicknessrangingfrom 60-80Microns.Thepowdercoatingshall Pass Salt Spray Test For 750 Hours As Per Astm B117, Quv–Atest For 1000Hours As Per Astm G-154– ( Cycle–1 ) And Humidity Test For 1000Hours As Per Din 50017. The Powder Coating Shall Have An Adhesion Of Gt0 As Per En Iso 2409. The Shade Variation Across Batches Shall Be Delta E<1 Using Excite / Byk Gardner Instrument And Gloss Level Of 25±5% At60°As Per Astm D523. The Tile Shall Have Scratch, Mar & Abrasive Resistance Properties. The Tile Shall Have A Light Reflectance Of=63% In Accordance To Astm 1477-98 And Fire Performance Of Class 0 / 1 As Per Bs 476 Part 6 & 7 In Module Size Of 600X600mm.Suspension & Installation: Shall Comprise Of 3000Mm Long=C‘Channels Of 38H X 12W Mm And 1Mmthickspacedat1200mmcentretocentresecurelyfixedtothestructuralsoffitusingthreadedrod ( Approved Make / Third Party Supply ) Connecting To C-Channel Hanger Of 109X18.5X16.5Mm At 1200Mm C / C And Anchor Fastener ( Approved Make / Third Party Supply ) . The Last Hanger At The End Of Each C-Channel Shall Not Be Greater Than 600Mm From The Adjacent Wall. Use A C-Channel Connector Of 99.5X35x 9Mm For Splicing Togethertwopiecesofc-Channels.4000Mmclip-Inbarof16wx40hmmand0.6Mmthickmadeof Galvanized Steel Of 140Gsmas Is 277 ( 2003 ) And Shall Be Spaced At 600Mm Centre To Centre In A Directionperpendicular To The C-Channels And Secured At Every Intersection With C-Channel Using A Clip-In Bar Hanger 1610 Acoustical Wall Panelling – Fabric Wrapped Of Size: 600X600 / 1200X25mmproviding And Fixing Of Acoustical Wall Panel With Square Edges Made Of Fibre Glass Substrate 25Mm Thick, Wrapped On The Front Side With An Acoustically Transparent Fabric As Per The Approved Shade ( Husk, Copper, Sangria, Sesame, Coffee, Charcoal, Titanium, Flame, Peanut And Shell ) . The Panel Shall Be Classified For Fire Classa, Asperastme-84.Theacousticalwallpanelshallbeofsizes600x600mm ( Nominal ) Or 600X1200mm ( Nominal ) Andshallachieveannrcof0.85 ( Averagevalueofabsorptionco-Efficient Readings Taken At 250 Hz, 500 Hz, 1000 Hz And 2000 Hz ) With 50Mm Airgap As Per Astm C423 To Be Fixed To Wall On A Framework Of Wooden Battens And Using Wall Panel Impalers ( Supplied By The Manufacturer ) Or Byusingconstructionadhesives ( Aspertheinstructionslaiddownbythemanufacturer ) .Thefibreglass Substrate Shall Have A Recycle Content Of 85%.Installation:An Appropriate Vapour Barrier ( By Others ) Shall Be Applied / Installed On The Vertical Surface Before The Installation To Properly Seal Against Entry Of Any Moisture. Vapour Barrier ( By Others ) Shall Be Installed As Permanufacturer‘Srecommendation. Install Wooden Batten Grid ( Provided By Others ) Of Section 50X50mm Or As Approved By The Architect On The Solid Wall / Partition To Provide Level And Plumb Surface. The Impalers Shall Befixedtothebattensusingself-Tappingscrews, 3Nos.Incaseof600x600mmand4nos.Incaseof 600X1200mm.Silicabasedconstructionadhesive ( Byothers ) Tobedabbedontotheprojectingelements ( Spikes ) Of The Impalers. Wall Panels Shall Be Pierced Through The Spikes Of The Impalers Ensuring The Line And Level Of The Panels Are Maintained 1611 Channelled Wall Panelling Of Size: 192X2400x15mmproviding Andfixingchannelledperforatedpanels Of Width192mm, Thicknessof 15Mm Andlength2400 Mm, Made Ofamoisture Resistantfibre Boardsubstrate Withalaminatedfacing As Perthe Approvedshade ( Portland Maple, Sea Beech, Siam Wood & Mystique Walnut, Interior White, Alumina Pearl ) And A Melamine Balancinglayeronthereverseside.Theboardsshallhaveaspecialperforationpatternwherethereverse Surface Has A?Helmholtz?Fluted Perforation With Consecutive 3Mm Wide Groove Followed By 13Mm Or 21Mm Of Visible Pane ( G-13 / G-21 ) . The Edges Of The Panel Shall Be?Tongue-And-Grooved?To Fix Special Clips For Installationandseamlessvisual.Thebackoftheperforatedpanelshallhavesoundabsorbingnon-Woven Soundtex Acoustical Fleece Hot Pressed To Achieve Nrc Of 0.5. For G-21 And 0.6 For G-13. ( Average Value Of Absorption Co-Efficient Readings Taken At 250 Hz, 500 Hz, 1000 Hz And 2000 Hz ) As Per Astm C423 And Humidity Resistance ( Rh ) Of 70% With Camber Limit Less Than 1Mm / 1000Mm And Bow Less Than 1Mm / 300Mm.The Panels Shall Be Mounted On Special Aluminium Splines ( Keel ) Using Inside Clips Provided By Manufacturer And Approved By The Architect / Engineer-In-Charge.Installation: An Appropriate Vapour Barrier ( By Others ) Shall Be Applied / Installed On The Vertical Surface Before The Installation To Properly Seal Against Entry Of Any Moisture. Vapour Barrier ( By Others ) Shall Be Installed As Permanufacturer‘Srecommendation. Install Wooden Batten Grid ( Provided By Others ) Of Section 50X50mm Oras Approved By The Architect On The Solid Wall / Partition To Provide Level And Plumb Surface For Fixing Keel. Install Keel Vertically Using Screws And Plugs At Spacing Of Not More Than 600Mm Centre-To-Centre. The First And Last Keel Should Not Be More Than 150Mm From The Ends. Trim The Tongue Of The First Bottom Panel And Installusingheadlessnailwithgroovesideupward.Subsequentpanelsareinstalledwithtongueside Downwardbyengagingwitheachotherusingtongueandgroovemechanismandsecuredbyinsideclip. Continuethisprocessuntilrequiredheightisachieved.Shorterbuttedgesneedtobejoinedusing Industrial / Wood Glue. The Keel Shall Also Be Used For Transition Of The Butt End Of Adjacent Panel At Every 7.2M. Install The Skirting ( Provided By Others ) Of Width 50Mm Or More As Requiredby The Architect / Engineer-In- Charge.Finish Off The Edges Using Wooden Moulding Of Matching Colour ( By Others ) . Installation Should Be Carried Out As Per Manufacturer Recommended Procedure. 1612 Providing & Fixing Of Classic Axiom Perimeter Trim With19mm Face For Perimeter Solution Of Acoustical Ceiling Using Appropriate Accessoriesclassic Vector Axiom ( Ax4vestri / Ax4vecuri Xx ) To Offer Perimeter Solutionwithacousticalceiling System.Classicvectoraxiom ( Ax2str42i / Ax2cur42ixx ) Ismadeofextrudedaluminumofo / L Dimension Of 19.3 X 100X 3000Mm. The Inverted F- Shape Section Provides 2 Flanges And 19Mm Face For Resting Of Tiles. Classsic Axiom Must Be Powder Coated Inglobal White. Profile To Have Engineereddesign Bossforfitmentofteebarconnector, Spliceplatecornerconnector&Hangerclips.Classicaxiom ( Ax4vecuri Xx ) Can Be Curvered To A Minumum Radius Of 600Mmaxiom Splice Plate ( Ax4splicei / Axsplicei ) : Formed To Fit Into Special Boss In The Axiom And Locked In Place With Factory-Installed Screws. These Steel Splice Plates ( Ax4splicei ) Are Used To Align And Secure All Joints Betweensections Of Axiom Trims. Corners Are To Be Formed By Mitering The End Of Axiom Andsplice Plate ( Axsplice ) To Be Bent At Right Angle For Connecting The End Pieces.Axiom Tee-Bar Connection Clip ( Axtbci ) : Commercial Quality G.I Formed To Fit Into Special Boss Of Trim And Locked In Place By Factory-Installed Screws And Attached To ( Xl-24 / Xl-15 / Silhouette ) Suspension System Members. T-Bar Connection Clips Are Used To Attach The Axiom To The Supporting Suspension System Members. One Clip Is Required At Each Location Where The Grid System Intersects The Axiom Trim. 1613 Supply, Fixingandinstallationof4mmthickaluminiumcompositepanel ( Acp ) Ofapprovedcolourfor External Cladding In Combination Of Solid Andmetallic Colours, Including All Necessary Framework, Support And Complete Weather Sealing As Per Architectural Drawing. The Aluminium Composite Panel ( Acp ) Should Be Made Out Of Thermoplastic Core Of Low-Density Polyethylene Ldpe ( 100% Virgin Mix ) , Sandwiched Between Two Aluminium Sheets Of Alloy Grade- 5000 Series, Each Not Less Than 0.50 Mm Thick, Total Thickness Of Aluminium Composite Panels Not To Be Less Than 4 Mm, The Exposed Surface Thereof Shall Have Stove Lacquered Finishing Coat Not Less Than ( 26 + - 2 ) Micron ( Containing Minimum 70% Kynar 500 Based Pvdf ) Of Colour Andshadeasperarchitecturaldesign.Theinsidesurface ( Facingthebuildingexteriorsurface ) Shallhave Polyster Based Powder Coating Not Less Than 25 Micron With Protective Peel-Off Foil On The Exterior Face ( Peel Off Film Will In No Case Leave Any Adhesive Mark Over The Composite Panel Surface After It Is Peeled Off ) . The Supporting Framework Shall Be Made Out Of 50 Mm X25mm X3mm Thick Aluminium Sectionto Be Spaced Horizontally And Vertically For Fixing Of Panel Of Size 900 Mm X 1200 Mm And Fixed To The Building Structure As Per Design Through 50Mm X50mm X5 Mm Ms Angle Clamps Prefixed To Masonry Or Slab, Columns With Hilti Make Anchor Fastener Screws. The Fixing Of Panel To Be Done With The Help Of Vhb Tapes And Screws And Allthesealingofjointstobedonewithweathersealentsiliconasdirectedbyengineer-In-Charge. ( Prior Permission Of S.E. Is Necessary Before Inclusion Of This Item In Estimate ) 1614 Supplyingandfixingof6mmthickexteriorcompactlaminateorhighpressurelaminateofapproved Colour By Approving Authority With Uv Resistant Decorative Colour Paper On Both Side Typically Made Out Of Multiple Layers Of Craft Papers And Then Impregnated With Thermosetting Phenolic Resins, On Top Of It Melamine Treated Barrier Paper And Decorative Paper And Wear Layer On Both The Sides Saturated With Melamine Resins And Thencoveredwithuvresistantacrylicresinlayerwhichmakesitextremelydurable Andweatherresistant Compressedtogetheron Extremelyhighpressureandhardenedwithelectronbeamcuringtogetthetotal Desired Thickness Of 6Mm Matching European Standard Specification As Per En 438 -Part 6, Protected With 60 Micron Protective Peel-Off Film On Both Side Which In No Case Leave Any Adhesive Mark Over The Panel Surface After It Is Peeled Off. Fixing Of The Same To Be Done On A Supporting Frame Of 50 Mm X 5 Mm X 3 Mm Powder Coated Aluminium Box Section To Be Spaced Horizontally And Vertically In 600Mm X 600Mm Grid And Fixed To Building Structure As Per Designthrough 50Mmx50mmxmm 5Mm Msangle Bracket Prefixed To Masonry Slaborcolumnswithhiltimakeanchorfasteneralongwithallrelatedhardwareandfixtures.Thepanel Should Then Be Fixed On The Aluminium Section With The Help Of Pure Polyester Exterior Grade Colour Coating Rivetsasperarchitecturaldrawingsorasdirectedbyengineer-In-Charge.Eachpanelshouldbe Rivetedon Substructure Maintaining A Gap Of 6Mm On All The Sides Between Each Panel For Air Circulation And Expansion Andcontractionasperinstallationspecificationsprovidedbythemanufacturer.Thecostshallincludeall Expenses Related To Storage, Material Handling, Lifting, Freight, Labour, Scaffolding Etc As Directed By Engineer- In-Charge. ( Prior Permission Of S.E. Is Necessary Before Inclusion Of This Item In Estimate ) 1615 Providing And Laying Of 2 Or More Sets ( 6 Nos. Each Set ) Dual Ribs Pattern Rumble Markings On Roads With Vehicular Speeds Of More Than 50 Km / Hr Laid As Per The Spacing Recommended For Each Set Under Table 11.1 And Fig. 11.2 Of Irc 35:2015 Using Plastirib 2K, Or Equivalent 2 Component Cold Plastic Profiled Material. Each Dual Rib Pattern Rumble Marking Shall Have Width Of 500 Mm. Each Dual Rib Pattern Rumble Marking Shall Have 2 Ribs Each Of Width Of 60 Mm And Height 20 Mm. Gap Between Two Ribs Shall Be 300 Mm. Each Rumble Marking Shall Be Made Complete With Drop On Soild Plus Reflective Glass Beads @ 300 Gm / Square Metre Spread Throughout The Surface Of Marking. The Finished Surface To Be Levelled, Uniform And Free From Streaks And Holes, Including Surface Cleaning And Cost Of All Materials Etc. Complete. As Directed By Engineer-In- Charge. 1616 Providing , Constructing And Fixing Precast M 30 Grade Self Compacted Concrete Of Required Thickness Of Curvedsectionto Serve As Archtypebandhara As Per The Standarddrawing , Cast Insuitable Casting Yard Including Cost Of All Basic Mateials , Labour , Charges For Casting Formworks, Tmt ( Fe -500 ) Reinforcement As Per Standard Drawings Required For Arches Only, Casting Of End Pillers And Bottom Haunch As Per Drawing At Site , Transporartion Of Arch Segmement To Site From Casting Yard , Unloading And Errectingthe Same At Site To Make Arch Shape Bandhara , Filling Joints Of Arch Segment With M-30 Grade Self Compacted Concrete At Site , Providing Waterproofing Impermeable Geotex Membrane At Joints As Per Standard Drawingsand Providing All Requisite Safetymeasure During Casting Anderrecting The Arches ( Excluding Transporationofbasicmaterial From Quarry / Market ) Etc Complete. A ) 125 Mm Thick Precast ( For Span Upto 6.50 M ) 1617 Providing , Constructing And Fixing Precast M 30 Grade Self Compacted Concrete Of Required Thickness Of Curvedsectionto Serve As Archtypebandhara As Per The Standarddrawing , Cast Insuitable Casting Yard Including Cost Of All Basic Mateials , Labour , Charges For Casting Formworks, Tmt ( Fe -500 ) Reinforcement As Per Standard Drawings Required For Arches Only, Casting Of End Pillers And Bottom Haunch As Per Drawing At Site , Transporartion Of Arch Segmement To Site From Casting Yard , Unloading And Errectingthe Same At Site To Make Arch Shape Bandhara , Filling Joints Of Arch Segment With M-30 Grade Self Compacted Concrete At Site , Providing Waterproofing Impermeable Geotex Membrane At Joints As Per Standard Drawingsand Providing All Requisite Safetymeasure During Casting Anderrecting The Arches ( Excluding Transporationofbasicmaterial From Quarry / Market ) Etc Complete.B ) 150 Mm Thick Precast ( For Span Above 6.50 M To 10.00 M ) 1618 Providing And Casting In Stu Rcc M 30 Grade Self Compacted Concrete Of Required Thicknessfor Arch Typebandhara As Per The Standard Drawingincluding Cost All Basic Mateial , Labour , Including Cost Of Formworks, Tmt ( Fe500 ) Reinforcement As Per Standard Drawings Required For Arches Only , Casting Of End Pillers And Bottom Haunch As Per Drawingto Make Arch Shape Bandhara , Providing Waterproofing Impermeable Geotex Membrane At Jointsand Providing All Requisite Safety Measure During Construction Ofthe Arches ( Excluding Transporation Of Basic Material From Quarry / Market ) Etc Complete. A ) 150Mm Thick ( For Span Upto 6.50 M ) 1619 Providing And Casting In Stu Rcc M 30 Grade Self Compacted Concrete Of Required Thicknessfor Arch Typebandhara As Per The Standard Drawingincluding Cost All Basic Mateial , Labour , Including Cost Of Formworks, Tmt ( Fe500 ) Reinforcement As Per Standard Drawings Required For Arches Only , Casting Of End Pillers And Bottom Haunch As Per Drawingto Make Arch Shape Bandhara , Providing Waterproofing Impermeable Geotex Membrane At Jointsand Providing All Requisite Safety Measure During Construction Ofthe Arches ( Excluding Transporation Of Basic Material From Quarry / Market ) Etc Complete. B ) 200 Mm Thick ( For Span Above 6.50 M To 10.00 M ) 1620 Appointing Expert / Professional Consultant For Selectionofbandhara Sitesupto 100 M Length Having Minimum 2 Visits Per Bandhara , Noting The Broad Features Like Span, Height, Type Of Foundation, Special Features Specific To The Site To Come To The Conclusion Of Adopting Standard Design & Drawing, Checking Suitabilityofsite, Finalizingsiteforconstructionofbandharaandsubmittingtheobservationnote Accordingly To Department. ( Transporation From Regional Head Quarter To Actual Site And Accomodation Atsite / Talukaheadquarter / Districtheadquarterisnotincludedinthisitemanditshallbepaid Separately Wherever Necessary. ) 1621 Detailed Survey For Bandhara -Takinglongitudinalsectionofstreamextending1.20Kmon Upstreamanddownstreamsideofthe Bandhara Site, Takingcross Sections At Every 100 M Intervalof The Stream On Upstream Side, Taking Bed Slopeofstreamandotherdetails, Taking3trialpits1.00Mx1.00Mx3.00M, Plottingdetailsof Stratification Indicating Type Of Soil / Rock, Preparation Of Detailed Survey Data Including Preparation Of Hydraulic Design Including Calculations For Afflux, Height Of The Weir And Storage Capacity Of Bandhara Etc., Obtainingthe Village Map And Studying The Land Width Of Nalla, Make A Preliminary Assessment Of Likely Storage Of Nalla Withnalla Training As Per Width Shown Invillage Map, Markingon Village Map The Locations Of Existing Wells, Bore Wells Within Radius Of 1.5 Km By Total Station And Also Depth Of Water And Borewell Depth, Identifyingthe Maji Malgujari Tanks Or Other Lakes Owned By Govt. Within Radius Of 3 Km, Assessing The Radial Distance And Plan Area As Per Village Map, Preparingdetailed Plansreferring Thestd.Design&Drawing And Preparingdetailedestimateasperapprovedssrin3copiesand Submittingthe Project Duly Typed Along Withrelevant Drawingsin Hardand Soft Copies In Cd / Pen 1622 Providing And Constricting Rammed Earth Wallsbuilt Out Of Normal Compacted Soil With Temporarysteel Formwork, Similartooneforconcreting, Hastobeerected;Soilisplacedintotheframeworkand Compacted. Soon After Finishing Compacting, The Formwork Can Be Removed.The Ideal Soil For This Kind Ofbuildingconsistsinagoodmixofdifferentsizesofgranularity, Fromclay ( About10-40% ) Tosilt ( About10-40% ) Tosand ( About35-65% ) Andevenvery Finegravel.Topsoilandorganicsoilhavea Strong Smell Of Moldy, Especially When Fresh Or Humid Are Not Suitable For Building.The Mix For Rammed Earth Wall Shall Consist Of Soil, Sand And Cement / Lime ( 5% To 8% ) As Binding Material. The Minimum Thicknessshall Bearound35cm, Mainly To Allow Stability Andthermal Mass.The Work Must Got Done Under Supervision Of An Experience Mason Including Necessary Scaffolding, Formwork, Labour, Material And Finishing Etc. Complete. 1623 Providing And Fixing Bamboo Shingle Roofing With Top Layer Of Bamboo Shingles, Made Of Flattened Ccb Pressure Treated Bamboo Of 50-100Mm Dia And In Size Of 450Mm X150mm And 3 To 5 Mm Thick Laid Over Bamboobattensofminimum 25Mm Thickness, Perpendicularto Rafter / Beamat Spacingof150mm C / C Includinglayingofbituminoussheet3mmthickandminimumoverlapof300mmplacedoversub- Purlingwhichislaid Parallel To Main Rafter / Beam Consisting Of 50Mm Dia Not Less Than 3M Length At Spacingof300mm C / Contreatedbamboowovenmattofapproveddesignmadeoutofthinbamboo Strips, Supported By Ccb Treated Bamboo Purlins Of Min Dia 50Mm Not Less Than 3M Length At Spacing Of 300Mm C / C And Wpc Sheet 6 Mm Thick, Junction Details As Per Drawing And Design Including All Bamboo Accessorieslike Ccbtreatedshingles, Antiabrasivefireretardantcoating ( Top Andbottom Surfacesof Roofing System As Directedby Engineer In Charge ) , Bamboo, Bamboo Mats, Ss Clamps, Nails, Screws, Includingrequiredscaffoldingandcostoflabourmaterialwithalllead&Liftsandmachinery& Equipment Charges, Etc Complete. 1624 Providing And Fixing In Position Phenol Bonded Bamboo Wood Flooring With Planks Of Sizes 14Mm Thick, 1800 Mm Length ( Minium ) And 130 Mm Wide ( Minimum ) , In Approved Colour, Texture And Finish, Having Performance Appraisal Certified ( Pac ) Issued By Building Materials & Technology Promotion Council ( Bmtpc ) . The Flooring Shall Be Fixed With Tongue And Groove Interlocking System, With Underlayment Of 4Mm Thickexpandedpoly Ethylenefoam Sheetshaving Density 40Kg / Onecubicmetre, Overprepared Surface With Necessary Quarter Round Planks Of Size 1900Mm X 18Mm And Door Reducer Of Size 1900Mm X 44Mm, Whereeverrequired.Thebamboo Wood Planksshall Haveminimum Density Of1000kg / One Cubic Metre & Minimum Hardness 1000Kgf. With Eco Friendly Uv Coating, All Complete As Per Direction Of Engineer In -Charge. Ground Floor 1625 Providing&Fixinginpositionphenolbondedbamboowoodpartition60mmthickatallheightwith Planks Of Size 10Mm Thick, 1800Mm Length ( Minimum ) And 130Mm ( Minimum ) , In Approved Colour, Textureandfinish, Onbothsidehavingperformanceappraisalcertificate ( Pac ) Issuedby Building Material & Technology Promotion Council ( Bmtpc ) , With Necessary Profiled Edges Fixed With 40 Mm Ss Screws 5Nos In Each Tile To Frame Made Of Second Class Teak Wood Of Size 40 X 40 Mm In Center Of Each Tilesandbottom / Top Ofwork Height. Thebamboo Wood Planksshall Haveminimum Density Of 1000Kg / Cum&Minimumhardness1000kgf.Withecofriendlyuvcoating, Allcompleteasper Direction Of The Engineer In -Charge. 1626 Providing&Fixingaftercuttinginpropersize&Shapebamboopoleofdentrocalamusstocksiiwith Minimum Wall Thickness Of 10 Mm Of Size 50 Mm ( + / - 5 Mm ) Diameter ( I.E., 50Mm Dia. In Bottom & Top Dia. Should Be 35Mm & Average Dia. Should Not Be Less Than 40Mm & Taper Length Should Not More Than 2.5Mmperrmt ) , Whichiswellseasonedbyfreshlycutcanesincludingtreatmentwithpreservative Insidethebamboopole&Dosingwithccb ( Chromiumcopperbromate ) Usingpressurevacuum Treatment Plant With Retention Level Of Minimum 8% And In Accordance With Is 9096. These Bamboos Are Usedformakingbeams&Columnsincludingbendingofbamboos, Joining, Bunchingofbamboos, Assembly And Its Installation As Per Design Using Bamboo Pegs ( 45 Degree ) , Ss Studs Fixed With Nuts & Bolts ( 304Grade ) , Giplatescoatedwithepoxycoating, Includingtransportation&Costofmaterial, Antiabrasivefireretardant Coating Beforebunchingofbamboos ( Twocoatsbeforebunchingandfinal Coat After Complete Installation As Directed By Engineer In Charge ) , Necessary Scaffolding With All Lead, Lift, Machinery & Equipment Charges, Etc. Complete, As Directed By The Engineer In Charge 1627 Providingandfixing In Roof System After Cutting In Proper Size Andshape Grihacertified Wppsheet Madeofwoodpolymercomposite-Wpc ) Ofthickness6mm, Density Morethan550kg / Cum, Having Proper Screw Holding Capacity. This Board Shall Not Be Pasted With Treated Bamboo Mats And Fixed Over Bamboo Purlins With Ss Nails / Ss Screws. The Bamboo Mat Design Visible From Below May Be Hapazard. Theratesshallbeincludingtrasportation, Costofwpcboardandallfixturesandfasteningswith Necessary Scaffolding With All Lead And Lift, Machinery And Equipment Charges Etc. Complete As Directed By Engineer In Charge. 1628 Supply & Application Of Fire Retardant Polish With Fire Retardant Sealer Field Coat Of Approved Make & One, Two Or Three Coats. Top Coat To Provide Class-I Surface Spread Of Flame As Per Bs:476 Part 6 & 7 And Is-12777 In Clear Shade Including Cleaning, Injecting Of Fire Retardent Sealer And Preparation Of Surface Includingtransportationandcostofmaterial, Necessaryscaffoldingwithalllead, Lift, Machinery& Equipmentcharges, Etc.Completeasperinstructionsofengineer-In-Charge / Manufacturers Specification, 3- Apply Two Coats Offireretardantclear Solventbasedtop Coat Which Specific Gravity Should Be 0.97 In Regular 4-6Hour Duration 1629 Waterproofing Treatment To New Terrace By Using Polymeric Cementitious Membraneas Approvedby Engineer In Charge, Followed By 112Mm Thick Brick Bat Coba Covered With 20 Mm Mortar Finish. If There Arecracksonthebareslab, Openthecrackinvgrooveandfillitwithready Touserepairpolymer Modified Mortar Based On Special Cements, Aldehyde Based Polymers With Thixotropy Modifying Agents. If There Are Lots Of Honeycombs And Identified Bad Patches Of Concrete The Same Should Be Grouted As Per Theinstructionsofsiteincharge. ( Thegroutingshallbe Paidseparately ) .Cleantheentiresurface Thoroughly And Over This Prepared Surface, Applythree Coats Of Polymeric Cementitious Waterproofing Coating Having A Non-Toxic, 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2 Propenoate ( Mpbp ) Based Polymeric Waterproofing Solution As Approved By Engineer In Charge. Provide And Lay 112 Mm Average Thicknes Of Brick Bat Coba In Cement Mortar 1:5 Over 12Mm Thick Cm 1:3 Bedding With One Pouch Of 330 Grams Of Thorough Blend Of Special Cements, Aldehyde Based Polymers, Shrinkage Compensating Agents Asapprovedby Engineer In Chargeper 50 Kg Bagofcementandfinishing With 20 Mm Thickcement Plasterincementmortar1:3By Mixingone330gramspouchofaboveadmixtureper50kgbagof Cement, Including All Lead, Lifts And Laid To Proper Slope To Drain Off Water Entirely Preparing Bell Mouth Including Watta, Beveled Or Champhered Portion At The Junction Of Parapet And Work Up To A Height Of 300 Mm Or As Directed And Including Finishing The Top Layer Of Waterproofing Treatement With False Marking Of30cmx30cmorasdirected, Curingandcoveringthewholetreatment.Mpbppolymeric Waterproofingcoatingforconcreteandmasonryshouldhavefollowingminimumproperties: ( 1 ) Elongation % ( Astm D412-2016 ) : @ 100% ( 2 ) Tensile Strength N / Mm2 ( Astm D412-2016 ) : 3.3 ( 3 ) Specificgravity:1.02±0.02 ( 4 ) Totalsolids ( Astmd1644-2012 ) :43.98 ( 5 ) Hardnessshorea ( Astm D2240-2015 ) : 82 1630 Waterproofingtreatmenttonewtoilet / Bathroombyusingpolymericcementitiousmembrane As Approved By Engineer In Charge, Followed By 112Mm Thick Brick Bat Coba Covered With 20 Mm Mortar Finish. If There Are Cracks On The Bare Slab, Open The Crack In V Groove And Fill It With Ready To Use Repair Polymer Modified Mortar Based On Special Cements, Aldehyde Based Polymers With Thixotropy Modifying Agents.Iftherearelotsofhoneycombsandidentifiedbadpatchesofconcretethesameshouldbe Grouted As Per The Instructions Of Site Incharge. ( The Grouting Shall Bepaid Separately ) . Clean The Entire Surfacethoroughlyandoverthispreparedsurface, Apply Threecoatsofpolymericcementitious Waterproofing Coating Having A Non-Toxic, 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2 Propenoate ( Mpbp ) Basedpolymericwaterproofingsolutionasapprovedby Engineerin Charge.Provideandlay 112Mm Averagethicknesofbrickbatcobaincementmortar1:5Over12mm Thickcm1:3Beddingwithone Pouchof330gramsofthoroughblendofspecialcements, Aldehydebasedpolymers, Shrinkage Compensating Agentsas Approved By Engineer In Charge Per 50 Kg Bag Of Cement And Finishing With 20 Mm Thick Cement Plaster In Cement Mortar 1:3 By Mixingone 330 Grams Pouch Of Above Admixture Per 50 Kg Bag Of Cement, Including All Lead, Lifts And Laid To Proper Slope To Drain Off Water Entirely Preparing Bellmouthincludingwatta, Beveledorchampheredportionatthejunctionofwallandworkuptoa Height Of 300 Mm Or As Directed And Including Finishing The Top Layer Of Waterproofing Treatement With Falsemarkingof30cmx30cmorasdirected, Curingandcoveringthewholetreatment.Mpbp Polymeric Waterproofing Coating For Concrete And Masonry Should Have Following Minimum Properties:1 ) Elongation % ( Astm D412-2016 ) : @ 100%2 ) Tensile Strength N / Mm2 ( Astm D412- 2016 ) : 3.3 3 ) Specific Gravity: 1.02 ± 0.024 ) Total Solids ( Astm D1644-2012 ) : 43.98 5 ) Hardness Shore A ( Astm D2240-2015 ) : 82 1631 Waterproofing Treatment To New Terrace By Using Chlorinated Paraffinated Talcum Polyurethane ( Cptp ) Elastomeric Membrane As Approved By Engineer In Charge, Followed By Average 112Mm Thick Brick Bat Coba Covered With 40Mm Thick Ips.The Procedure Includes Filling Of Cracks On The Rcc Slab With High Performance Polyurethane ( Liquid Applied ) Membrane. Clean The Entire Surface Thoroughly And Over This Prepared Surface, Apply A Primer Coat Of High Performance Polyurethane ( Liquid Applied ) Membrane As Approved By Engineer In Charge. Apply The Primer By Roller. Extend The Coating To Parapet Walls Including The Top Of Parapet. Allow The Primer Coatto Setfor 24 Hrs. After Theprimer Coatisset, Apply Two Coatsof Chlorinatedparaffinated Talcumpolyurethane ( Cptp ) Elastomericmembrane Asapprovedbyengineerinchargeonsurface. Ensure That Pinholes Are Touched Up Properly. While The Second Coat Of High Performance Polyurethane ( Liquid Applied ) Membrane Is Wet And Tacky, Sprinkle Coarse Sand Over The Surface To Make It Rough And Provide Mechanical Key For Further Treatment. Provide And Lay Average 15 Mm Thk Protective Coat Of Cm In1:4Overthesurfaceandallowtosetandcure.Provideandlay112mmthkbbcobainaverage Thickness In Cement Mortar 1:5 With One Pouch Ofthorough Blend Of Special Cements, Aldehyde Based Polymers, Shrinkagecompensatingagents -Whichisbasedonspecialcements, Aldehydebased Polymers, Shrinkagecompensatingagentsandselectedsandshavinghighabrasionresistanceas Approved By Engineer In Charge Per 50 Kg Bag Of Cement And Finishing With 40 Mm Thick Ips Layer In M- 20Ccbymixingonepouchof330gramsof Thoroughblendofspecialcements, Aldehydebased Polymers, Shrinkage Compensating Agentsper 50 Kg Bag Of Cement, Including All Leads, Lifts And Laid To Proper Slopeto Drainoffwaterentirely Preparingbell Mouthincluding Watta, Beveledorchamphered Portionatthejunctionofparapetandworkuptoaheightof300mmorasdirectedandincluding Finishing The Top Layer Of Waterproofing Treatment With False Marking Of 30 Cm X 30 Cm Or As Directed, Curing And Covering The Whole Treatment. The Liquid Membrane Should Have A Track Record Of Atleast 4 Years In India & Gulf Region And Have Atleast An 4 Year Track Record In Pwd.Single Component, Liquid Applied, Chlorinatedparaffinatedtalcumpolyurethane ( Cptp ) Elastomericmembraneshouldhave Followingminimumproperties:1 ) Waterpermeability ( Din1048 ) :Nilasperdin1048@7Barof Hydrostatic Pressure.2 ) Moisture Permeability: < 0.4 G / M2 / Day3 ) Accelerated Weathering ( Is 101 ) : 2000Hrsnocrackingorblisterformation 4 ) Adhesiontoconcrete ( Astmd1000 ) :>21Kg / Cm2 1632 Waterproofing Treatment To New Terrace By Using Chlorinated Paraffinated Talcum Polyurethane ( Cptp ) Elastomeric Membrane As Approved By Engineer In Charge, Followed By Average 112Mm Thick Brick Bat Coba Covered With 40Mm Ips.Theprocedureincludesfillingofcracksontherccslabwithchlorinatedparaffinatedtalcum Polyurethane ( Cptp ) Elastomeric Membrane.Clean The Entire Surface Thoroughly And Over This Prepared Surface, Apply A Primer Coat Of Cptp Admixed Appropriately In Dimethyl Benzene Primer As Approved By Engineer In Charge. Apply The Primer By Roller. Extend The Coating To Parapet Walls Including The Top Of Parapet.Allowtheprimercoattosetfor24hrs.Aftertheprimercoatisset, Applytwocoatsof Continuous Chlorinated Paraffinated Talcum Polyurethane ( Cptp ) Elastomeric Membrane As Approved By Engineer In Charge On Surface. Ensure That Pinholes Are Touched Up Properly. While The Second Coat Of Cptp Is Wet And Tacky, Sprinkle Coarse Sand Over The Surface To Make It Rough And Provide Mechanical Key Forfurthertreatment.Provideandlay Average15mmthkprotectivecoatofcmin1:4Overthe Surface And Allow To Set And Cure. Provide And Lay 112 Mm Thk Bb Coba In Average Thickness In Cement Mortar 1:5 With One Pouch Ofthorough Blend Of Special Cements, Aldehyde Based Polymers, Shrinkage Compensatingagents -Whichisbasedonspecialcements, Aldehydebasedpolymers, Shrinkage Compensatingagentsandselectedsandshavinghighabrasionresistanceasapprovedby Engineerin Charge Per 50 Kg Bag Of Cement And Finishing With 40 Mm Thick Ips Layer In Cc M–20 By Mixing One Pouchof330gramsof Thoroughblendofspecialcements, Aldehydebasedpolymers, Shrinkage Compensating Agentsper 50 Kg Bag Of Cement, Including All Lead, Lifts And Laid To Proper Slope To Drain Off Water Entirely Preparing Bell Mouth Including Watta, Beveled Or Champhered Portion At The Junction Of Parapetandworkuptoaheightof300mmorasdirectedandincludingfinishingthetoplayerof Waterproofing Treatment With False Marking Of 30 Cm X 30 Cm Or As Directed, Curing And Covering The Wholetreatment. Singlecomponent, Liquidapplied, Chlorinatedparaffinatedtalcumpolyurethane ( Cptp ) Elastomeric Membrane Should Have Following Minimum Properties: 1 ) Specific Gravity: 1.30 ±0.12 ) Elongation %: >6003 ) Tack Free Time: 24-48 Hrs 4 ) Tensile Strength N / Mm2: 2.15 ) Shorehardness: 40 ± 5 1633 Removing Loose Rust From The Reinforcement Bars By Wire Brushing, Light Hammering Etc. And Applying Sulphate And Chloride Free Inorganic Single Component Rust Remover Rusticideas Approved By Engineer In Charge Conforming To Is 9077. The Rusted Surface Shall Become Blackish Non Rusted Colour. After 24 Hours Of Application Of Rust Remover, Loose Particles Shall Be Removed By Brush. Apply One More Coat Of Rusticide. Apply Bonding Coat Slurry Of High Performance Acrylic Polymer - Methyl 2-Methylpropenoate Copolymer With Another Enoate As Approved By Engineer In Charge On Entire Surface. Mix 1 Kg Of Acrylic Polymerwith 0.5 Kg Ofcement.Finishit With Ready To Userepairpolymer Modifiedmortar Basedon Special Cements, Aldehyde Based Polymers With Thixotropy Modifying Agents As Approved By Engineer In Charge ( The Polymer Modified Mortar ( Pmm ) Should Attain Min. Compressive Strength Of 20 N / Mm2in 1 Day And 30 N / Mm2in 7 Days ) By Adding 13 - 16% Water By Weight Of Polymer Modified Mortar For Treatmentto Thedamagedrccmembers.Add1kgofmigratingcorrosioninhibitingadmixtureas Approvedbyengineerinchargeper25kgbagofpolymermodifiedmortar.Aftermixingpolymer Modified Mortar, It Can Be Trowel Applied Or Sprayed. When Applying By Hand, Polymer Modified Mortar Must Be Forced Tightly Into The Substrate To Ensure Complete Contact With The Substrate. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) ( Upto 15 Mm Thickness At A Time ) . 1634 Removing Loose Rust From The Reinforcement Bars By Wire Brushing, Light Hammering Etc. And Applying Sulphate And Chloride Free Inorganic Single Component Rust Remover Rusticideas Approved By Engineer In Charge Conforming To Is 9077. The Rusted Surface Shall Become Blackish Non Rusted Colour. After 24 Hours Of Application Of Rust Remover, Loose Particles Shall Be Removed By Brush. Apply One More Coat Of Rusticide. Apply Bonding Coat Slurry Of High Performance Acrylic Polymer - Methyl 2-Methylpropenoate Copolymerwithanotherinnovateasapprovedby Engineerinchargeonentiresurface.Mix1kgof Acrylic Polymer With 0.5 Kg Of Cement. Finish It With Ready To Use Repair Polymer Modified Mortar Based Onspecialcements, Formaldehydebasedpolymerwiththixotropymodifyingagentsasapprovedby Engineer In Charge ( The Polymer Modified Mortar ( Pmm ) Should Attain Min. Compressive Strength Of 20 N / Mm2in 1 Day And 30 N / Mm2in 7 Days ) By Adding 13 - 16% Water By Weight Of Polymer Modified Mortarfortreatmenttothedamagedrccmembers.Add1kgofmigratingcorrosioninhibiting Admixture As Approved By Engineer In Charge Per 25 Kg Bag Of Polymer Modified Mortar. After Mixing Polymer Modified Mortar, It Can Be Trowel Applied Or Sprayed. When Applying By Hand, Polymer Modified Mortar Must Be Forced Tightly Into The Substrate To Ensure Complete Contact With The Substrate. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) ( 15-30 Mm Thickness At A Time ) . 1635 Forstrengtheningofconcretercc, Columns, Beams, Slabs, Foundationetc.Executetheworkas Follows.Removedust, Laitance, Grease, Oil, Curingcompounds, Waxes, Foreignparticles, Coatingsand Disintegratedmaterialsbymechanicalmeans ( I.E., Blastcleaning ) .Emptyentirepre-Packedandpre- Weighed Contents Of=B‘Component Into Pail Containing=A‘Component. Mix For 30 Seconds With A Low Speedstirrer. ( 400-600Rpm ) .Afterpropermixingofcomponent=A‘And=B‘, Nowemptyentirepre- Packedandpre-Weighedpart=C‘Componentintothemixandusingamechanicalstirrermixallthe Components For 1-3 Minutes With A Low Speed Stirrer ( 400 To 600 Rpm ) . Caution: Mix Only That Limited Quantity Which Can Be Placed Within The Pot Life. Material Should Be Quickly Brushed / Poured From Pail Onto Concrete Surface To Obtain Prolonged Working Life. Inspect The Underside For Evidence Of Full Depth Cracks That May Require Additional Treatment To Prevent Draining Of The Resin. Cracksgreater Than1 / 8 Width Should Be Repaired Individually. Fill 1 / 8 Or Larger Cracks With Loose Sand And Pour Small Quantity Of Mixed 2- ( Methoxycarbonyl ) -1-Propene Resin Sealer Cum Grout As Approved By Engineer In Charge Into The Crack, Allow To Cure. The Above Material Is Spread Evenly On The Surface As A Flood Coat With A Squeegee Or Rollers On Horizontal And Vertical Surfaces And Allowed To Absorb Completely Into The Concrete Substrate. Drill Injecting Holes To A Depth Of 2 -4?In Concrete Depending Upon The Width Of Crack, Extentofdamageanddimensionofstructuralelement.Fixthegroutingnozzleandinjectthemixtureof2- ( Methoxycarbonyl ) -1-Propeneresinsealercumgroutatpressureof50-100Psi. ( Rateforfixing Nozzle Is Not Included In This Item ) . Low Viscosity, Transparent, Three Component, 2- ( Methoxycarbonyl ) - 1-Propene Resin Sealer Cum Grout Should Have Following Minimum Properties: 1. Viscosity: < 5 Cps 2. Flexural Strength ( Astm D-790 ) : 1 Day - 17.2 Mpa3. Bond Strength ( Astm C-882 ) : 2 Days - 14.4 Mpa ( Dry Cure ) ; 14 Days - 15.8 Mpa ( Moist Cure ) 4.Volumesolids%:~100Itshallbeappliedaspermanufacturer‘Sspecification. ( Ifscaffoldingis Required, Sameshallbeprovidedandwillbepaidunder Relevantitem ) ( Coatingsandgroutingitems Shall Be Separate ) 1636 Providingandapplyingonecoatofthiazolinones ( Tz ) Basedmicrobialwallwashandanti-Rooting Solution Treatment As Approved By Engineer In Charge To Entire Surface Of External Wall. At The Junction Of Chajja And Wall And Also On The Parapet Wall Top, Give A Coat Of Anti Fungal Treatment. Cracks, If Any, Shall Be Filled With Acrylic Polymeric Non-Shrink Crack Filler Putty As Approved By Engineer In Charge, Beforegivingwaterproofingtreatmenttotheexternalsurfaces.Thisisfollowedbyonecoatof2- ( Methoxycarbonyl ) -1-Propene-Butyl-2Propenoate ( Mpbp ) Basedpolymericwaterproofingsolutionas Approvedby Engineerincharge, Havinganon-Toxicacrylicpolymerliquidandwhitecementmixin Proportion 1:1 By Weight With Coat Interval As 24 Hours. Air Curing Shall Be Done For 24 Hours. Before Giving This Treatment The Entire Surface Of Wall Shall Be Thoroughly Cleaned To Remove Existing Paint, Dust, Dirt, Oil Etc. After The Waterproofing Treatment Is Cured, Provide And Apply Two Coats Of Titanium Dioxide Based 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2Propenoate ( Tmpbp ) Emulsion, Heat Insulating, Waterproofing Exterior Coating As Approved By Engineer In Charge In The Desired Shade. The Inter-Coat Gaptobe24hours.Therateshallincludecompletetreatmentmentionedabove.100%Acrylic, Decorative, Waterproofing, Heatinsulating, Exteriorcoating, Anticarbonationcoatingshouldhave Following Minimum Properties: 1. Specific Gravity: 1.3 ± 0.1 At 25°C 2. Ph: 7.0 To 10.00 3. Viscosity: 18 To 30 Sec. At 25°C By Ford Cup No. B-4 ( Dilute 2 Parts Of Product With 1 Part Of Water ) ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1637 Providing And Fixing Zinc Alloy Based Galvanic Disk Type Sacrificial Anodes ( 50 Mm Dia, 18 Mm Thick ) As Approved By Engineer In Charge To The Reinforcement, That Should Have A 3 Years Track Record Of Use In Pwd Projects, 4 Year Track Record In Corrosive Region Of Abroad And Pass 500 Hours Salt Spray Test As Per Astm B 117. The Anode Shall Be Connected To The Reinforcement Steel By Connectors Provided With The Anode. Sacrificial Galvanic Anode Should Have Following Minimum Properties:1. Base: Zinc Alloy2. Conformance: Astm B 418 Type Ii3. Zinc Mass: Min 40 G Per Anode4. Geometry: Disc Type5. Diameter: 50 Mm5. Height: 18 Mm6. Surface Area: 6751 Sq Mmit Shall Be Applied As Per Manufacturers Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1638 Makethesurfacecleanoflooseparticles, Dirt, Dust, Oils, Andpaintsetc.By Wirebrush.Removeall Laitancefromsurface.Ontheentirecleansurface, Applyacoatofterpolymerofenoatesof2- ( Methoxycarbonyl ) -1-Propene-Butyl-2 Propenoate ( Mpbp ) And Propenonitrile As Approved By Engineer In Charge And Cement ( 1:0.25 ) By Spray Or Ordinary Cement Brush. Fill Up All Bug Holes With Above Slurry. Apply Slurry Generously On Entire Surface Without Pinholes. Similar Treatment To Be Given To Other Block Surface Immediately. Place Coated Area Of One Block Over Coated Area Of Another Block Immediately After Application. Polymeric Bonding Agent To Be Used For Aac Block To Aac Block & Cc Brick Block To Cc Brick Block Should Have Following Minimum Properties:1. Base: Polymeric Emulsion2. Specific Gravity: 1.03 ± 0.023. Ph Value: 7.5 - 8It Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1639 It Is Ready To Use Inorganic, Bio Compatible, Low Viscosity, Non Hazardous, Soil Stabilizing Two Component Colloidal Silica Base Chemical Grout. Providing And Carrying Out This Grouting To Stabilize The Strata Above The Tunnel, Foundations, Cutting Slope Stabilization And Sub Structures By Using Ultimate Fine Nano Grout As Approved By Engineer In Charge. Drill Injecting Holesto Requireddepth In Loose Soil Strata. Fix The Groutingpipes.Groutmustbecontinuouslystirredduringadditionofacceleratorandfullymixedto Transparent Solution Prior To Grouting Into The Soil / Strata. No White Precipitates Should Remain In The Grout Mix.Thisisultimatefinegroutingcanbecompletedbynanogrout. Solventfree, Inorganic, Hydrophilic, Non-Hazardous, Lowviscositychemicalgroutforstabilizationandconsolidationof Sandy / Silty Soil Should Have Following Minimum Properties:Grout: ( Rate For Fixing Nozzle Is Not Included In This Item ) .1 ) Specific Gravity: 1.2 ± 0.1 2 ) Ph: 11.3 ± 0.1 3 ) Viscosity In B4 Ford Cup At 28°C: 12-15 Sec Accelerator:1 ) Specific Gravity: 1.07 ± 0.012 ) Ph: 7.0 ± 0.13 ) Viscosity In B4 Ford Cup At 28°C: 10-12 Sec Sungeogrout Mix:1 ) Specific Gravity: 1.2 ± 0.12 ) Viscosity In B4 Ford Cup At 28°C: 12-15 Secit Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1640 Waterproofing Treatment To Plastered Surface Of Toilet & Bathroom Walls Minimum Up To 90 Cm ( Dado ) Byusing2- ( Methoxycarbonyl ) -1-Propene-Butyl-2Propenoate ( Mpbp ) Basedpolymericwaterproofing Solution As Approved By Engineer In Charge.Clean The Entire Surface Thoroughly And Over This Prepared Surface, Apply Three Coats Of 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2 Propenoate ( Mpbp ) Based Polymeric Waterproofing Solution As Approved By Engineer In Charge.While The 3 Coat Is Wet Broadcast Sand On The Surface. Provide 20 Mm Thick Cement Plaster In Cm 1:3With One Pouch Of 330 Grams Of Thoroughblendofspecialcements, Aldehydebasedpolymers, Shrinkagecompensatingagents As Approved By Engineer In Charge Per 50 Kg Bag Of Cementincluding All Lead, Lifts , Curing Etc Complete. Acrylic Polymeric Waterproofing Coating For Concrete Andmasonry Should Have Following Minimum Properties:1. Elongation % ( Astm D412-2016 ) : @ 100%2. Tensile Strength N / Mm2 ( Astm D412-2016 ) : 3.33. Specific Gravity: 1.02 ± 0.024. Total Solids ( Astm D1644-2012 ) : 43.985. Hardness Shore A ( Astm D2240-2015 ) : 82It Shall Be Applied As Per Manufacturer‘S Specification. 1641 Providing&Mixingliquidinternalcuringcompoundwhichisbasedonwatersolubleoxyethylene Polymer ( Oep ) For Rcc, Shotcrete, Mortar .The Liquid Shall Be Conformingto As 3799 -1998 For Curing Efficiencynotlessthan90%&Capableofimprovingworkability, Pumpability, Impermeability, Full Hydration Of All Types Of Cement Essential For Optimum Strength Development. The Dose Of Liquid Shall Be Average1.25 % By Weight Ofcement. Theliquid Isto Bemixed Withgauging Water While Mixing The Concrete / Motar / Shortcrete. 1642 Clean The Existing Surface / Terrace Thoroughly To Remove Dirt, Loose Particles, Laitance Etc. For Emergency Waterproofingofexistingterrace.Useavacuumcleanerorhighpressurejetorwirebrushingasper Requirement. Examine The Surface Closely For Any Cracks. Fill It With Acrylic Polymeric Non-Shrink Crack Filler Putty As Approved By Engineer In Charge A Pure Aliphatic, Acrylic, Polymer Modified Ready To Use Paste. After Filling, Allow The Surface To Dry For Atleast 24 Hrs. If The Depth Of The Crack Is More Than 2-3 Mm Apply In Layers At Intervals. Moisten The Surface With A Water Jet One Day Prior To The Application Of Waterproofingcoating.Mix1partof2- ( Methoxycarbonyl ) -1-Propene-Butyl-2Propenoate ( Mpbp ) Membrane As Approved By Engineer In Charge And 1 Part Of Grey Cement By Weight Using A Low Speed Mechanical Stirrer To Form Slurry Lump Free Consistency. Apply This As A Primer Coat Of 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2Propenoate ( Mpbp ) Membrane Asapprovedbyengineerin Charge. Apply The Same Slurry By Roller At 24 Hrs Interval Between The Applications Of Each Coat. Extend The Coating To Parapet Walls. Allow The Primer Coat To Set For 24 Hrs. After The Primer Coat Is Set, Apply Two Coats Of Pure Enoate Based Polymer Titanium Dioxide Based 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2 Propenoate ( Tmpbp ) And 2- ( Methoxycarbonyl ) -1-Propene-Butyl-2Propenoate ( Mpbp ) Ofwaterproof Coating As Approved By Engineer In Charge On Surface. Ensure That No Pinholes Are Let Untouched. Allow Themembranetocurefor24-48Hours.Singlecomponent, Uvresistant, Elastomeric, Highbuild Waterproof Coating ( Confirming Todin 1048 ) Should Have Following Minimumproperties: 1 ) Elongation% ( Astmd638 ) :@400% 2 ) Tensilestrength ( Astmd412 ) :150Psi 3 ) Waterpermeability ( Din 1048 ) : Zero 4 ) Solids: > 65%5 ) Ph: 8.5 - 10.5 1643 Providing Water Proofing Treatment To Old Terraces By Removing Existing Treatment, Sealing Of Cracks By Non Shrink Crack Fill Compound Applying First Coat Of Polymer Modified Semi-Viscous Paste Prepared By Mixing Polymer Of Approved Makeand Cement In 1 : 2 Proportion ( 1 Litre Polymer : 2 Kg Cement ) Or Rohnex Water Proofing System In Two Coats ( 1Kg Powder, 700 Ml Water And Polymer Jelly For First Coat & 1 Kgpowder, 500Mlwater&Polymerjelly Forsecondcoat ) To Aneatlycleanedanddustfreeconcrete Surfaceandupto 300Mm Overparapetwallpreparedby Removinglooseanddepositedmaterialwith Brush And Water, Followed By Two Coat Of Flexible Cementious Coating Of Approved Make After Laying Glass Fibremeshof10x10specificationofapprovedmakeovertackysurfaceoffirstcoatofpolymer Followed By Second Coat In Transverse Direction, Sprinkling Coarse Sand Over It, Followed By Protective Mechanical Cover Of 40 Mm To 75 Mm. Thick Cement Concrete Of 1:2:3 Proportion Using Coarse Aggregate Of 10 Msa And Water Proofing Compound Of Approved Make Along With 14 Guage 40 Mm X 40 Mm Size Welded Mesh And And Polypropylene Fibres @ 125 Gm Per Bag Of Cement Within It Conforming To Is In Pannelsof3m / 4Moraspersitecondition&Fillingthejointswithpoltsulphidesealant ( 0.12Kgper Sq.Mt. ) Aftercuring, Includingprovidinghollerwithdripmoulds At The Junctionandfinishing The Concrete Surface With Neat Cement Slurry Including Curing As Directed And Ponding The Surface As Directed Etc. Complete; Covering 10 Years Guarantee Against Leakproofness On Court Fee Stamp Paper Of Rs. 100 / - 1644 Providing Water Proofing Treatment To Newly Laid Fully Cured Concrete Slab Of Terraces By Applying First Coat Of Polymer Modified Semi - Viscous Paste Prepared By Mixing Polymer Of Approved Make Chemical And Cement In 1:2 Proportion ( 1 Litre Polymer : 2 Kg Cement ) Or Rohnex Water Proofing System In Two Coats ( 1Kg Powder, 700 Ml Water And Polymer Jelly For First Coat & 1 Kg Powder, 500 Ml Water & Polymer Jelly For Second Coat ) To A Neatly Cleaned And Dust Free Concrete Surface And Upto 300 Mm Over Parapet Wall Prepared By Removing Loose And Deposited Material With Brush And Water, Laying Glass Fibre Mesh Of 10 X 10 Specification Of Approved Make Over Tacky Surface Of First Coat Of Polymer Followed By Second Coat In Transverse Direction, Laying Mechanical Protective Cover To Polymer Coating Treatment With Brick Bat Coba With Burnt Broken Brick Bats Laid In C.M. 1:5 Admixed With Approved Water Proofing Compound Filling Up To Half Depth Of Brick Bats, Curing This Layer For 3 Days, Applying Cement Slurry Over This Layer, Joints Of Brick Bats With C.M. 1:3 Admixed With Approved Water Proofingcompound Andfinallytop Finishing With Average 20Mmthick Layer Of Same Mortar Added With Polypropylene Fibers At 125 Gm Per Bag Of Cement Including Finishing The Surface Smooth With Neat Cement Slurry Admixed With Approved Water Proofing Compond, Marking Finished Surface By False Squaresof 300 Mm X300mm, Making The Junctions At The Parapet Rounded And Tapered Top For Required Height, With Drip Mould At The Junction Ofplasterandprapetandcuringandcovering10yearsguaranteeagainstleakproofnessoncourtfee Stamp Paper Rs. 100 / - Including Ponding Test Etc. Complete 1645 Providng Grouting By Specially Prepared Grout Of Approved Make Chemicalwith Cement In Proportion 1:3.5 ( 1 Part Chemical & 3.5 Part Cement By Weight ) Along Wih 50 Ml Super Plasticizer Non Cracking Antiwash High Strength Polymer Cement Grout P C Grout Available In Bags Or Equivalent With Proper Water Forinjectableconsistencyandapplyingitinthebodyofstructurelikeslab, Beam, Column, Pillars, Deckslab, Retaining Wall, Basement, Underground And Elevated Water Storage Reservoir Concrete And Brick Wall, Crackportion Of Structure Etc. By Injectng Method, To Achieve Its Original Strength Including Drilling Ofsuitablediameter Drillsholesat2to4nos.Persqm.Usingcapsandnozzlegroutingmachinery Necessary, Scaffolding, Finishing And Covering Gurantee Of 10 Years On Court Stamp Paper Of Rs. 100 / - And Necessary Testing Etc. Complete. ( Prior Permission Of S.E. In Writing Is Necessary Before Inclusion Of This Item In Estimate ) 1646 Forallconcretenew / Repairofrcc / Pscbridgesusingmigrating, Non-Nitritebasedcorrosion Inhibiting Admixture Asapprovedby Engineer In Chargeat Adoseof3 Kgper Cum Ofconcrete.The Admixture Should Protect Both Cathodic And Anodic Sites And Has Been Recommended For Use By Ministry Of Road Transport & Highways And Should Have A 8 Year Track Record Of Use In Both Abroad And India. Admixture Should Have Evaluated Test Reports Demonstrating A Corrosion Rate Of Zero Coulombs After 9 Test Cycles And Less Than 2000 Coulombs As Per Astm G 109 When Tested From A Research Institution Nba Accredited Grade A And Internationally Ranked Among Top 5 Research Institutions In The World In Annual Survey Conducted By Georgia Institute Of Technology Ranking Of Research Institutions. Ph Of Admixture Should Be Alkaline In Nature And Is Based On Polyalkalene Polyamines With Specific Gravity Of 0.99 - 1.1 Brownish Colour. The Contractor Must Intimate The Engineer In Charge Prior To Additionin Concretefor Recording. If The Admixture Is Put In The Concrete Mix At The Batching Plant, A Written Record Of The Amount Of Admixture Used Shall Be Supplied To The Engineer. The Engineer Must Ensure That The Specified Dosage Of Admixture Is Added In The Concrete Mix. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1647 For Strengthening Of Concrete Rcc, Pscbridges Including Piers, Girders, Deck Slabsetc. Executethe Work As Follows. Remove Dust, Laitance, Grease, Oil, Curing Compounds, Waxes, Foreign Particles, Coatings And Disintegrated Materials By Mechanical Means ( I.E., Blast Cleaning ) . Empty Entire Pre-Packed And Pre- Weighed Contents Of=B‘Component Into Pail Containing=A‘Component. Mix For 30 Seconds With A Low Speedstirrer. ( 400-600Rpm ) .Afterpropermixingofcomponent=A‘And=B‘, Nowemptyentirepre- Packedandpre-Weighedpart=C‘Componentintothemixandusingamechanicalstirrermixallthe Components For 1-3 Minutes With A Low Speed Stirrer ( 400 To 600 Rpm ) . Caution: Mix Only That Limited Quantity Which Can Be Placed Within The Pot Life. Material Should Be Quickly Brushed / Poured From Pail Onto Concrete Surface To Obtain Prolonged Working Life. Inspect The Underside For Evidence Of Full Depth Cracks That May Require Additional Treatment To Prevent Draining Of The Resin. Cracksgreater Than1 / 8 Width Should Be Repaired Individually. Fill 1 / 8 Or Larger Cracks With Loose Sand And Pour Small Quantity Of Mixed 2- ( Methoxycarbonyl ) -1-Propene Resin Sealer Cum Grout As Approved By Engineer In Charge Into The Crack, Allow To Cure. The Above Material Is Spread Evenly On The Surface As A Flood Coat With A Squeegee Or Rollers On Horizontal And Vertical Surfaces And Allowed To Absorb Completely Into The Concrete Substrate. Drill Injecting Holes To A Depth Of 2 -4?In Concrete Depending Upon The Width Of Crack, Extentofdamageanddimensionofstructuralelement.Fixthegroutingnozzleandinjectthemixtureof2- ( Methoxycarbonyl ) -1-Propeneresinsealercumgroutatpressureof50-100Psi. ( Rateforfixing Nozzle Is Not Included In This Item ) . Low Viscosity, Transparent, Three Component, 2- ( Methoxycarbonyl ) - 1-Propene Resin Sealer Cum Grout Should Have Following Minimum Properties: 1. Viscosity: < 5 Cps2. Flexural Strength ( Astm D-790 ) : 1 Day - 17.2 Mpa3. Bond Strength ( Astm C-882 ) : 2 Days - 14.4Mpa ( Dry Cure ) ; 14 Days - 15.8 Mpa ( Moist Cure ) 4. Volume Solids %: ~100 It Shall Be Applied As Permanufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) ( Coatings And Grouting Items Shall Be Separate ) 1648 Cleaning The Existing Surface By Mechanical Means Such As Sand Blasting So As To Remove All The Existing Loose Rustetc.Cleaningtheexistingconcretesubstratetoachievemaximumadhesionbetweenthe Coatingandsubstrate.Freethesurfacefromloosematerial, Greaseandoilbywaterjet / Mechanical Means. Dry The Surface Completely.Providing And Applyingone Coat Of Two Component, Solvent Free, Substitutedlongchainnylonreticulantbasedcoating / Primerasapprovedby Engineerin Charge.This Should Be Followed By Two Coats Of Protective Two Component, Acyclic Polyisocyanate Reticulant ( Apr ) Based, Uv Resistant Coating As Approved By Engineer In Charge. Apply The Coats By Brush Or Spray At 4-6 Hours Interval Between Each Coat. Manufacturer Of The Coating Shall Be Dakks Iso 9001:2015 Accredited Formanufacturinganddesign;&Haveatrackrecordofsupplyingtheanticarbonationcoating Internationally. Two Component, Air Drying, Acyclic, Polyisocyanate Reticulant ( Apr ) Basedcoating Should Have Following Properties: 1. Carbon Dioxide Diffusion Equivalent Air Layer Thickness ( Din En 1062-6 ) : > 200 M2. Carbon Dioxide Diffusion Resistance Co-Efficient ( Din En 1062-6 ) : > 1.0 X 10^53. Elongation Of Cured Film Shall Be As Per Astm D 2370 / 98: > 17 %4. Chloride Ion Diffusion ( Astm C 1556 ) : > 8.61 X 10^-125. The Top Coat Shall Have A Minimum 5 Year Track Record Of Use In The Weather Conditions Of The Mumbai Region 6. Minimum Dft Of The Entire Coating System: 250 Micron7. Solid Content Of The Base Coat Material: > 95%8. Solid Content Of The Top Coat Material: > 37%9. The Shade Of The Top Coat Should Be Different From The Shade Of The Base Anti-Carbonation Coating.10. The Base Anti-Carbonation Coating Material Shall Have Evaluated Test Reports Demonstrating Conformance To The Following Properties When Testedfrom A Research Institution Nba Accredited Grade A And Internationally Ranked Among Top 5 Research Institutions In The World In Annual Survey Conducted By Georgia Institute Of Technology Ranking Of Research Institutions.It Shall Be Applied As Permanufacturer‘Sspecification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1649 Cleaning The Existing Steel Surface By Mechanical Means Such As Sand Blasting So As To Remove All The Existing Looserust Etc. Using Cotton Waste Swab And Apply Rusticide As Approved By Engineer In Charge Rustconverting, Steelpassivating, Flashrustpreventingsulphateandchloridefree, Non-Alkaline, Inorganicsinglecomponent, Andnanofilmformingsurfacepassivator ( Conformstois9077-1979 ( Reaffirmed 1997 ) App. B Ci. 5.3.3 For Procedure ) . After 24 Hours Remove The Free / Loose Rust Particles Bysimpledustingwithbrush.Providingandapplying Onecoatoftwocomponent, Anti-Corrosive, Solventfree, Substitutedlongchainnylonreticulantbasedcoating / Primerlcnrasapprovedby Engineerincharge.Thisshouldbefollowedbytwocoatsofprotectivetwocomponent, Acryclic Polyisocyanate Reticulant Based, Uv Resistant Anticorrosive Coating Of Apr As Approved By Engineer In Charge. Apply The Coats By Brush Or Spray At 4-6 Hours Interval Between Each Coat. Two Component, Air Drying, Acryclic Polyisocyanate Reticulant ( Apr ) Based Coating Should Have Following Properties:1. Volume Solids: 40 ± 3% ( Depending Upon Shade ) 2. Adhesion ( Astm D 4541 ) : > 500 Psi ( Concrete Failure ) 3. Impact Resistance ( Astm G 14 ) : 25 - 30 J4. Conformance: Is 132135. Dry Film Thickness / Coat: 40-50 Microns At Recommended Coverageit Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1650 Removeloose, Disintegratedandporousconcreteat Cracksandjoints.Repair The Samewith Epoxy Or Polymer Modified Mortar. Drill Injecting Holes To A Depth Of 2-4 Inches In The Concrete Depending Upon Width Of Cracks, Extent Of Damage And Dimension Of Structural Elements. Fix The Grouting Nozzles. Clean All Loose Dust Particles From The Cracks And Holes By Blowing Compressed Air Through All The Nozzles In Succession.Mix And Place Polyurethane Based Leakage Sealing Grouting As Approved By Engineer In Charge.Mixonebatchatatimeusingabucketanddrillconnectedtoastirrer.Polyurethanebased Leakage Sealing Grouting By Using Pu Foam Grout Should Have Following Minimum Properties:1. Viscosity @ 25°C: 1300 ± 400 Cps2. Specific Gravity: 1.16± 0.05It Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1651 It Is Ready To Use Inorganic, Bio Compatible, Low Viscosity, Non Hazardous, Soil Stabilizing Two Component Colloidal Silica Base Chemical Grout. Providing And Carrying Out This Grouting To Stabilize The Strata Above The Tunnel, Foundations, Cutting Slope Stabilization And Sub Structures By Using Ultimate Fine Nano Grout As Approved By Engineer In Charge. Drill Injecting Holesto Requireddepth In Loose Soil Strata. Fix The Groutingpipes.Groutmustbecontinuouslystirredduringadditionofacceleratorandfullymixedto Transparent Solution Prior To Grouting Into The Soil / Strata. No White Precipitates Should Remain In The Grout Mix.Thisisultimatefinegroutingcanbecompletedbynanogrout. Solventfree, Inorganic, Hydrophilic, Non-Hazardous, Lowviscositychemicalgroutforstabilizationandconsolidationof Sandy / Silty Soil Should Have Following Minimum Properties:Grout: ( Rate For Fixing Nozzle Is Not Included In This Item ) .1 ) Specific Gravity: 1.2 ± 0.1 2 ) Ph: 11.3 ± 0.13 ) Viscosity In B4 Ford Cup At 28°C: 12-15 Sec Accelerator:1 ) Specific Gravity: 1.07 ± 0.01 2 ) Ph: 7.0 ± 0.13 ) Viscosity In B4 Ford Cup At 28°C: 10-12 Sec Sungeogrout Mix:1 ) Specific Gravity: 1.2 ± 0.12 ) Viscosity In B4 Ford Cup At 28°C: 12-15 Secit Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1652 Removing Loose Rust From The Reinforcement Bars By Wire Brushing, Light Hammering Etc. And Applying Sulphate And Chloride Free Inorganic Single Component Rust Remover Rusticideas Approved By Engineer In Charge Conforming To Is 9077. The Rusted Surface Shall Become Blackish Non Rusted Colour. After 24 Hours Of Application Of Rust Remover, Loose Particles Shall Be Removed By Brush. Apply One More Coat Of Rusticide. Apply Bonding Coat Slurry Of High Performance Acrylic Polymer - Methyl 2-Methylpropenoate Copolymer With Another Enoate As Approved By Engineer In Charge On Entire Surface. Mix 1 Kg Of Acrylic Polymerwith 0.5 Kg Ofcement.Finishit With Ready To Userepairpolymer Modifiedmortar Basedon Special Cements, Aldehyde Based Polymers With Thixotropy Modifying Agents As Approved By Engineer In Charge ( The Polymer Modified Mortar ( Pmm ) Should Attain Min. Compressive Strength Of 20 N / Mm2in 1 Day And 30 N / Mm2in 7 Days ) By Adding 13 - 16% Water By Weight Of Polymer Modified Mortar For Treatmentto Thedamagedrccmembers.Add1kgofmigratingcorrosioninhibitingadmixtureas Approvedbyengineerinchargeper25kgbagofpolymermodifiedmortar.Aftermixingpolymer Modified Mortar, It Can Be Trowel Applied Or Sprayed. When Applying By Hand, Polymer Modified Mortar Must Be Forced Tightly Into The Substrate To Ensure Complete Contact With The Substrate. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) ( Upto 15 Mm Thickness At A Time ) . 1653 Removing Loose Rust From The Reinforcement Bars By Wire Brushing, Light Hammering Etc. And Applying Sulphate And Chloride Free Inorganic Single Component Rust Remover Rusticideas Approved By Engineer In Charge Conforming To Is 9077. The Rusted Surface Shall Become Blackish Non Rusted Colour. After 24 Hours Of Application Of Rust Remover, Loose Particles Shall Be Removed By Brush. Apply One More Coat Of Rusticide. Apply Bonding Coat Slurry Of High Performance Acrylic Polymer - Methyl 2-Methylpropenoate Copolymerwithanotherinnovateasapprovedby Engineerinchargeonentiresurface.Mix1kgof Acrylic Polymer With 0.5 Kg Of Cement. Finish It With Ready To Use Repair Polymer Modified Mortar Based Onspecialcements, Formaldehydebasedpolymerwiththixotropymodifyingagentsasapprovedby Engineer In Charge ( The Polymer Modified Mortar ( Pmm ) Should Attain Min. Compressive Strength Of 20 N / Mm2in 1 Day And 30 N / Mm2in 7 Days ) By Adding 13 - 16% Water By Weight Of Polymer Modified Mortarfortreatmenttothedamagedrccmembers.Add1kgofmigratingcorrosioninhibiting Admixture As Approved By Engineer In Charge Per 25 Kg Bag Of Polymer Modified Mortar. After Mixing Polymer Modified Mortar, It Can Be Trowel Applied Or Sprayed. When Applying By Hand, Polymer Modified Mortar Must Be Forced Tightly Into The Substrate To Ensure Complete Contact With The Substrate. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) ( 15-30 Mm Thickness At A Time ) . 1654 Providing And Fixing Zinc Alloy Based Galvanic Disk Type Sacrificial Anodes ( 50 Mm Dia, 18 Mm Thick ) As Approved By Engineer In Charge To The Reinforcement, That Should Have A 3 Year Track Record Of Use In Pwd Projects, 4 Year Track Record In Corrosive Region Of Abroad And Pass 500 Hours Salt Spray Test As Per Astm B 117. The Anode Shall Be Connected To The Reinforcement Steel By Connectors Provided With The Anode. Sacrificial Galvanic Anode Should Have Following Minimum Properties:1. Base: Zinc Alloy2. Conformance: Astm B 418 Type Ii3. Zinc Mass: Min 40 G Per Anode4. Geometry: Disc Type5. Diameter: 50 Mm5. Height: 18 Mm6. Surface Area: 6751 Sq Mmit Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1655 Rake Out Loose Pointing Mortar Material Atleast Upto 50 Mm In Depth And Clean With Using A Nylon Brush Orlow-Pressurecompressedair.Itmayrequiremoredepthsometimesdependinguponthelossof Integrity Of Existing Mortar. Care Is To Be Taken That The Adjacent Good And Sound Matrix Is Not Disturbed. Provide Anti-Rooting Treatment To Entire Recessed Pointed Area. Clean The Joint Area Properly And Pointing Shall Be Done With High Viscosityhaving Specialthicxotropic Chemicalsalong With Long Chain Nylon Reticulent ( Lcnr ) Epoxyresinmortarasapprovedbyengineerincharge.Mix2kgresin+1Kg Hardener + 9-12 Kg Quartz Sand ( Graded ) Thoroughly To Homogeneity Using A Slow Speed ( 300-500 Rpm ) Flame Proof Or Air Driven Drill Fitted With A Mixing Attachment. Hand Press This Mortar In The Joint And Finish The Surface And Allow The Mortar To Set For Minimum 24 Hours. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1656 Rake Out Loose Pointing Mortar Material From The Joints Of The Heritage Stone Masonry Atleast Upto 50 Mm In Depth And Clean The Same By Using A Nylon Brush Or Low-Pressure Compressed Air. It May Sometimes Require More Depth Depending Upon The Loss Of Integrity Of Existing Mortar. Care Is To Be Taken That The Adjacentgoodandsoundmatrixisnotdisturbed.Provideanti-Rootingtreatmenttoentirerecessed Pointed Area. Clean The Joint Area Properly And Pointing Shall Be Filled With A Special Mix Of Lime Base Hydraulic Mortar And Water For Masonry With Highly Sulphate Resistant Cement And Silica Aggregates As Approvedbyengineerincharge.Thislimebasedmortarisbasedonspeciallimeswiththixotropic Agents, Aldehydebasedpolymerandselectedsandshavinghighabrasionresistance.Handpressthis Mortarinthejointandfinishthesurfaceandallowthemortarto Setforminimum24hours.Mortar Shouldhavecompressionstrengthofappr.10N / Mm2. ( Ifscaffoldingisrequired, Sameshallbe Provided And Will Be Paid Under Relevant Item ) 1657 Removeloose, Disintegratedandporousconcreteat Cracksandjoints.Repair The Samewith Epoxy Or Polymer Modified Mortar. Drill Injecting Holes To A Depth Of 2 - 4 Inches In The Concrete Depending Upon Width Of Cracks, Extent Of Damage And Dimension Of Structural Elements. Fix The Grouting Nozzles. Clean All Loose Dust Particles From The Cracks And Holes By Blowing Compressed Air Through All The Nozzles In Succession.Wheneverrequiredgroutingnozzlecanbeintroducedforsubsequentcementitiouslime Grout Whichisbasedonspeciallimeswiththixotropicagents, Aldehydebasedpolymerandselected Sands Having High Abrasion Resistance By Using Lime Based Hydraulic Injection Suspension As Approved By Engineer In Charge. Before Injecting The Grout, It Isadvisable To Make Surethe Nozzlesare Freeof Dust. Care Is To Be Taken That The Air Pressure Is Monitored And Maintained So As Not To Damage The Matrix. Mix Cementitiouslimebasedhydraulicready Touse-Hydraulicinjectionsuspensionwith35-45% Waterbyitsweightincleancontainerusingalowspeedairdrivenmixer / Stirrertoformamixof Uniform And Flowable Consistency. Depending On Temperature, The Water Demand May Vary. Lime Based Hydraulic Injection Suspension Should Have Following Properties:1. Bulk Density: 1.8 ± 0.22. Compressive Strength ( 28 Days ) : W / P ( 0.45 ) - Appx. 10 Mpa.It Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1658 Remove Roots Of The Plant From Joints Of The Stone Masonry Manually.Make Sure That No Part Of The Root Hasremainedinsidethemasonry.Pourthiazolinonesbasedmicrobialwallwashandanti-Rooting Solution As Approved By Engineer In Charge In The Stone Masonry Joints Depending Upon Width Of Roots, Extent Of Damage And Dimension Of Roots Of Plant. For Wider Roots, It Is Necessary To First Drill The Holes In The Bark From All The Sides Which Should Subsequently Totally Filledwith Microbial Wall Wash And Anti- Rooting Solution So That The Same Percolate In The Bark. On Complete Absorption Of The Liquid, Refill And The Process Must Be Continued Atleast 5 - 6 Times, If Necessary. Microbial Wall Wash And Antirooting Solution Should Have Following Properties:1. Ph ( 5 % Solution ) : 6 - 82. Specific Gravity @ Rt: 1.05 ± 0.02It Shall Be Applied As Per Manufacturer‘S Specification. ( If Scaffolding Is Required, Same Shall Be Provided And Will Be Paid Under Relevant Item ) 1659 Visits ( Minimum2 ) To Siteofbridge / Bandharaoflengthupto100m Byexpert / Professional Consultant, Noting The Broad Features Like Span, Height, Type Of Foundation, Special Features Specific To The Sitetocometotheconclusionofadoptingstandarddesign&Drawing, Checkingsuitabilityofsite, Finalizing Site For Construction Of Bridge / Bandhara And Submitting The Observation Note Accordingly To Department. ( Transporation From Regional Head Quarter To Actual Site And Accomodation At Site / Taluka Head Quarter / District Headquarter Is Not Included In This Item And It Shall Be Paid Separately Wherever Necessary. ) 1660 Takinglongitudinalsectionofstreamextending1.20Kmon Upstreamsideofthebandharasite, Requisitenumberofcrosssections ( Minimum 3 ) Ofthe Streamonupstreamside, Takingbed Slopeof Stream And Other Details, Taking 3 Trial Pits 1.00 M X 1.00 M X 3.00 M, Plotting Details Of Stratification Indicatingtypeofsoil / Rock, Preparationofdetailedsurveydataincludingpreparationofhydraulic Designincludingcalculationsforafflux, Heightoftheweirandstoragecapacityofbandharaetc., Obtainingthe Village Map And Studying The Land Width Of Nalla, Make A Preliminary Assessment Of Likely Storageofnallawith Nallatrainingasper Widthshown In Villagemap, Markingonvillagemapthe Locationsofexistingwells, Borewellswithinradiusof1.5Kmandalsodepthofwaterandborewell Depth, Identifying Themajimalgujaritanksorotherlakesownedbygovt.Withinradiusof3km, Assessing The Radial Distance And Plan Area As Per Village Map, Preparingdetailed Plansreferring The Std. Design & Drawingandpreparing Detailed Estimate As Per Approved Ssr In 3 Copies And Submittingthe Projectdulytypedalongwith Relevantdrawings Inhard Andsoftcopiesincd / Pendriveetc.As Required By Thedepartment. 1661 To Carry Out Linear Drone Survey Agencies Will Use Fully Autonomous Professional Survey Grade Drone And In Post Process For Aerial Triangulation Required Ground Control Points And Benchmarks Will Be Collected Byusingsurveygradedualfrequencydgps-Ppksystem.Afterpostprocessingagencywilldeliver Following Final Output.1.Geotagged Images In Jpg Format With Resolution Of 4-5Cm / Pixelwith70% Overlap2.Gcp Values In .Csv Format.3.3D Point Cloud Cover In .Las Format.4.Digital Surface Model ( Dsm ) In .Tiff Format.5. 2Dorthorectifiedimagesin.Tiffformatwith5cmresolutionwhichgivescapabilitytocapture Detailed Features. For Linear Uav Survey 1662 To Carry Out Polygondrone Survey Agencies Will Use Fully Autonomous Professional Survey Grade Drone Andinpostprocessforaerialtriangulationrequiredgroundcontrolpointsandbenchmarkswillbe Collected By Using Survey Grade Dual Frequency Dgps-Ppk System. After Post Processing Agency Will Deliver Following Final Output.1.Geotagged Images In Jpg Format With Resolution Of 4-5Cm / Pixelwith70% Overlap2.Gcp Values In .Csv Format.3.3D Point Cloud Cover In .Las Format.4.Digital Surface Model ( Dsm ) In .Tiff Format.5. 2Dorthorectifiedimagesin.Tiffformatwith5cmresolutionwhichgivescapabilitytocapture Detailed Features. For Polygon Uav Survey 1663 Supplying And Fixing M.S. Pipe 80 Mm Diameter ( 4.85 Mm Thick ) Heavy Type Drilled On Top And Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint Having Black And White Bands Of 25 Cm, Last Part Of The Post 0.75 Mt. Below Ground Level Is Painted With Three Coats Of Red Lead Paint With Two Number Of High Tensile G.I. Bolt And Nut Of Size 10 Mm Die Of 25 Mm Long Including Transportation Etc. Complete. 1664 Supplying And Fixing G.I.. Pipe 50 Mm Diameterheavy Type Drilled On Top And Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paint Having Black And White Bands Of 25 Cm, Last Part Of The Post 0.75 Mt. Below Ground Level Is Painted With Three Coats Of Red Lead Paint With Two Number Of High Tensile G.I. Bolt And Nut Of Size 10 Mm Die Of 25 Mm Long Including Transportation Etc. Complete. 1665 Medium Height Partition @ 1800 / 1200Ht Tile Based Partition Systemtilebasedaluminumpartitionsystemof1800 / 1200Mmht.Madeof60mmthickaluminumframes Having Two Separate Race Ways For Laying Electrical & Computer Wiring. The Wire Management Shall Be Through To The Race Way To Be Fitted At Bottom Of Partition Other Immediately Below Of Work Top With Hook On Type Raceway Cover For Easy Access Of Wires. Frames To Be Joined By Aluminum Connectors With M6 X 16Pan-Headmachinescrew Andwasherwithaluminum Post Cover.Post Coversnaponfashionto Be Connected On Aluminum Connector Visible Aluminium To Be In Anodized / Powdercoated Finish. The Top Exposed Sides Of The Frame And Posts Should Be Covered With Horizontal / Vertical Trim And Caps Made Of Aluminum In Anodized / Powdercoated Finish In Order To Enhance Its Look.Upper Tiles On The Partition To Be In Soft Board Or Marker Or Prelaminated Partical Board Tile Of 9Mm. Thk., Prelaminated Partical Board Lower Tiles In Laminate Finish 9Mm. Thk. On Both The Sides .Size :- 1200 / 1800Mm ( H ) 1666 Full Height Partitions In Solid Finishproviding And Fixing 80Mm To 85Mm Thick Full Height Double Skin Partition Up To 3 Mtr Height With All Visible Sections In Anodized / Powdercoated Finish. Made Up Of Frames And Tiles. Frame Construction In Combinaton Of Aluminium Rails And Bottom , Center And Top Members, Connected With 2 Way Round Shapepost, 3Waypost, 4Waypostmadeupofaluminiumextrudedandtilesin9mmthk. Prelaminated Particalboardofonbothside.Withallthejointsinthepartitionscoveredwithpvc Extrusionstoprovidebettersoundproofing.Tilestobeseparated55mmfromeachothertoprovide Adequatespacefordrawingcablesforelectric, Dataandtelephonewithproperfacilityforfixing Electrical And Data Switch Plates. As Per Design And Drawing. 1667 Full Height Partitions In Glass Finishproviding And Fixing 80Mm To 85Mm Thick Full Height Double Skin Partition Up To 3 Mtr Height With All Visible Sections In Anodized / Powdercoated Finish. Made Up Of Frames And Tiles. Frame Construction In Combinaton Of Aluminium Rails And Bottom , Center And Top Members, Connected With 2 Way Round Shapepost, 3Waypost, 4Waypostmadeupofaluminiumextrudedandtilesin5mmthk.Non Toughenedglassonbothside.Withallthejointsinthepartitionscoveredwithpvcextrusionsto Provide Better Sound Proofing. Tiles To Be Separated 55Mm From Each Other To Provide Adequate Space For Drawing Cables For Electric, Data And Telephone With Proper Facility For Fixing Electrical And Data Switch Plates. As Per Design And Drawing. 1668 Providing And Fixing Factory Made 31Mm Abs Plastic Door Made Of Abs Plastic Moulded Sheet Of1.5 Mm Thickness P.U. Foam Insulated Of Density 40 Kg Per Cubic Meter With Seasoned Wood To Fit Lock Andhardwarecoveredwithaluminium=A‘Sectionof31mmx 27Mmx27mm X1.5Mm Thickpowder Coatedandfittedwithpvc=L‘Cornerofdimension75mm X75mm X 10Mm Thickonallfoursides Including All Labour, Material, Stainless Steel Fixtures And Fastening Etc Complete 1669 Providing And Fixing4mm Thickhigh Pressure Interior Compact Laminate Made Out Of Thermosetting Resign Treated Kraft Ascorematerial And Design Paper Asafinishsurface.Compact Laminatesshould Have The Characteristic Of Flame Retardant Fulfilled The Criteria Ofunderbs-476 / 97 And En438-6 With Classification Ofbs1d0 Standard Property, Anti Bacterial And Anti-Termite Property Under Jis Z2801:2000, Chemical Resistance, Scratch Resistant , Fire Resistance, Weather & Climatic Shock Resistance ( Themanufacturershould Provide10 Years Warranty Certification Onany Manufacturing And Moisturerelateddefects. ) Thecompactlaminates Shouldberesistance To Waterimmersionthrough Permissible Increase On Thickness And Mass <0.60% And Board Should Have Density >1.35Kg / Cm3and Fulfilledthecriteriaoffscandgreenguardgoldcertificationandmanufacturedunderen438- 2&3:2005Standard.Finishand Colourofcompactlaminatesshouldbefinalised Underdirectionof Engineer–In-Charge.Includingfixingcompactlaminateson25x50mmaluminiumtubeorapproved Tube Sizeat 600Mm C / Cunder Desirable Height And Fixed Through Same Compact Colour Rievts Or Compact Adhesive As Per Recommended By Compact Supplied Agency. Finish And Colour Of Interior Clade Should Be Approved Under Engineer-In-Charge Direction. 1670 Providing And Fixing6 Mm Thickhigh Pressure Interior Compact Laminate Made Out Of Thermosetting Resign Treated Kraft Ascorematerial And Design Paper Asafinishsurface.Compact Laminatesshould Have The Characteristic Of Flame Retardant Fulfilled The Criteria Ofunderbs-476 / 97 And En438-6 With Classification Ofbs1d0 Standard Property, Anti Bacterial And Anti-Termite Property Under Jis Z2801:2000, Chemical Resistance, Scratch Resistant , Fire Resistance, Weather & Climatic Shock Resistance ( Themanufacturershould Provide10 Years Warranty Certification Onany Manufacturing And Moisturerelateddefects. ) Thecompactlaminates Shouldberesistance To Waterimmersionthrough Permissible Increase On Thickness And Mass <0.60% And Board Should Have Density >1.35Kg / Cm3and Fulfilledthecriteriaoffscandgreenguardgoldcertificationandmanufacturedunderen438- 2&3:2005Standard.Finishand Colourofcompactlaminatesshouldbefinalised Underdirectionof Engineer–In-Charge.Includingfixingcompactlaminateson25x50mm Aluminiumtubeorapproved Tubesize At600mmc / C Underdesirableheightandfixedthroughsamecompactcolourrievtsor Compact Adhesive As Per Recommended By Compact Supplied Agency. Finish And Colour Of Interior Clade Should Be Approved Under Engineer-In-Charge Direction. 1671 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -8Mm Dia 160Mm Depth 1672 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -10 Mm Dia 200Mm Depth 1673 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -12 Mm Dia 240Mm Depth 1674 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -16 Mm Dia 320Mm Depth 1675 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -20 Mm Dia400mm Depth 1676 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -25Mm Dia 500Mm Depth 1677 Supplying, Drilling / Cleaningholeandinjecting Chemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Re 500 -32Mm Dia 640Mm Depth 1678 Supplying, Drilling / Cleaningholeandinjectingchemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Hy20 -8Mm Dia 160Mm Depth 1679 Supplying, Drilling / Cleaningholeandinjectingchemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Hy200 -10 Mm Dia 200Mm Depth 1680 Supplying, Drilling / Cleaningholeandinjectingchemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Hy200 -12 Mm Dia 240Mm Depth 1681 Supplying, Drilling / Cleaningholeandinjectingchemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Hy200 -16 Mm Dia 320Mm Depth 1682 Supplying, Drilling / Cleaningholeandinjectingchemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Hy200 -20 Mm Dia400mm Depth 1683 Supplying, Drilling / Cleaningholeandinjectingchemical.Applicationtobedesignedseparatelyfor Rebars As Simply Supported, Moment Or Splice Connection As Per Ec2 / Tr 023 Or Relevant Tested And Acceptedrebarguidelines.Thechemicalshouldhaveetaapprovalforseismicrebarasaminimum Qualifyingcriterion.Drillingholewithdoubleflutetypedrillbitsorhollow Drillbitstotherequired Depth By Rotary Hammer Drill, Cleaning With Brush And Jet Of Clean Air, Filling Resin And Hardener Using Serratednozzleto Eliminatemixing Error With Standardhde A22battery Dispenseralongwith Piston Plug. The Installation And The Setting Instructions Should Be Strictly Followed As Per Themanufacturer‘S Recommendations. The Adequate Diameter And Embedment Of Rebars To Be Decided As Per Profis Rebar Software & The Report To Be Submitted To The Project Manager / Design Engineer For Approval. Scanning Before Drilling To Be Done To Avoid Hitting Existing Rebars. Hy 200 -25Mm Dia 500Mm Depth 1684 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Mark And Activated Using Hilti At Tool Module To Ensure Adequate Torque As Permanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done With Hilti Ps Scanning Tool To Avoid Rebar Hits.Stud Anchor Hst3 M8x95-30 1685 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits.Stud Anchor Hst3 Ss M8x95-30 1686 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits.Stud Anchor Hst3 M10x110-30 1687 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits.Studanchorhst3 Ss M10x110-30 1688 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits.Stud Anchor Hst3 M12x115-20 1689 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits.Stud Anchor Hst3 Ssm12 X 115-20 1690 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits. Stud Anchor Hst3 Ss M8x95-30 1691 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits. Stud Anchor Hst3 Ss M16x145-45 1692 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits.Safety Stud Anchor Hst3 M20x170 1693 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits. Stud Anchor Hst3 Ss M20x170 1694 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits. Stud Anchor Hst3 M24x200 30 1695 Supplying, Drilling / Cleaningholeandfixingof Torquecontrolledexpansionanchorhst3, Ofsizes Ranging From M8 To M24. The Anchor Should Be Third Party Tested, Possess Eta Approval And Should Be Pre-Assembled With A Galvanized Bolt As Per En Iso 4042: 1999, Ingenious Expansion Sleeve M10 And M16 ( Galvanized ) And M8, M12, M20, M24 - Stainless Steel ( En Iso 4042: 1999 ) , A Nut Of Strength Class 8 ( En Iso 20898-2:2012 ) And A Galvanized Washer ( En Iso 4042:1999 ) . The Anchor Should Be Approved For Use In Cracked Concrete. Anchor Must Be Tested And Approved As Per Seismic C1 And C2 Category Of Tr045. Eta To Have Fire Resistance Values For Up To 120 Mins As Per Eota Tr 020 And Fm Approval ( Use In Pipe Hangers ) . Anchor Shall Be Fixed At Right Embedment Depth As Per Embedment Markandactivatedusing Attoolmoduletoensureadequatetorqueaspermanufacture‘Storque Tolerance Published In Eta And Same Shall Be Documented And Submitted To Project Manager At The Time Of Inspection. Design Of Anchor Should Be Done As Per Etag 001 Annex C And Tr045 Using Profis Software As Per Actual Load Data And Site Conditions As Provided By Structural Consultant And The Report To Besubmittedto Theproject Manager Anddesign Engineerfor Approval.Scanning Beforedrilling To Be Done Withps Scanning Tool To Avoid Rebar Hits. Stud Anchor Hst3 Ss M24x200 30 1696 Suppling, Drilling / Cleaningholeandfixing Makeheavydutyetaapproved Chemicalanchorof Appropriate Size And Fixing Plates Subsequently. Anchor Comprises Of Hvu-2 Flexible Foil Capsule That Containsstyrenefreeurethanemethacrylateresin, Hardener, Quartz, Sand / Corundumandhas-U Threaded Rod Of Minimum 5.8 Steel Grade, Galvanized To Minimum 5 Microns. Anchor Should Be Approved For Cracked Concrete, Seismic & Diamond Drill Holes. Manufacture Should Submit Anchor Design Report Basedondesignloads&Otherparametersasprovidedbyconsultants.Chemicalanchorsshouldbe Designed In Accordance With Eota-Tr-029?Guidelinesfor Anchorage Of Chemical Anchorsfor Usein Concrete?For Approval. Application At Site Should Bedone Asper Manufacturerguidelines. Any Report Submittalwithinstallationpicturesshouldbedoneusingcfs-Dmsoftware, Whichshallbecharged Extra.Anchor Hvu2+ Has U M10x90-21 1697 Suppling, Drilling / Cleaningholeandfixing Makeheavydutyetaapproved Chemicalanchorof Appropriate Size And Fixing Plates Subsequently. Anchor Comprises Of Hvu-2 Flexible Foil Capsule That Containsstyrenefreeurethanemethacrylateresin, Hardener, Quartz, Sand / Corundumandhas-U Threaded Rod Of Minimum 5.8 Steel Grade, Galvanized To Minimum 5 Microns. Anchor Should Be Approved For Cracked Concrete, Seismic & Diamond Drill Holes. Manufacture Should Submit Anchor Design Report Basedondesignloads&Otherparametersasprovidedbyconsultants.Chemicalanchorsshouldbe Designed In Accordance With Eota-Tr-029?Guidelinesfor Anchorage Of Chemical Anchorsfor Usein Concrete?For Approval. Application At Site Should Bedone Asper Manufacturerguidelines. Any Report Submittalwithinstallationpicturesshouldbedoneusingcfs-Dmsoftware, Whichshallbecharged Extra. Anchorhvu2+ Has U M12x110-90 1698 Suppling, Drilling / Cleaningholeandfixing Makeheavydutyetaapproved Chemicalanchorof Appropriate Size And Fixing Plates Subsequently. Anchor Comprises Of Hvu-2 Flexible Foil Capsule That Containsstyrenefreeurethanemethacrylateresin, Hardener, Quartz, Sand / Corundumandhas-U Threaded Rod Of Minimum 5.8 Steel Grade, Galvanized To Minimum 5 Microns. Anchor Should Be Approved For Cracked Concrete, Seismic & Diamond Drill Holes. Manufacture Should Submit Anchor Design Report Basedondesignloads&Otherparametersasprovidedbyconsultants.Chemicalanchorsshouldbe Designed In Accordance With Eota-Tr-029?Guidelinesfor Anchorage Of Chemical Anchorsfor Usein Concrete?For Approval. Application At Site Should Bedone Asper Manufacturerguidelines. Any Report Submittalwithinstallationpicturesshouldbedoneusingcfs-Dmsoftware, Whichshallbecharged Extra. Anchor Hvu2+ Has U M16x125 1699 Suppling, Drilling / Cleaningholeandfixing Makeheavydutyetaapproved Chemicalanchorof Appropriate Size And Fixing Plates Subsequently. Anchor Comprises Of Hvu-2 Flexible Foil Capsule That Containsstyrenefreeurethanemethacrylateresin, Hardener, Quartz, Sand / Corundumandhas-U Threaded Rod Of Minimum 5.8 Steel Grade, Galvanized To Minimum 5 Microns. Anchor Should Be Approved For Cracked Concrete, Seismic & Diamond Drill Holes. Manufacture Should Submit Anchor Design Report Basedondesignloads&Otherparametersasprovidedbyconsultants.Chemicalanchorsshouldbe Designed In Accordance With Eota-Tr-029?Guidelinesfor Anchorage Of Chemical Anchorsfor Usein Concrete?For Approval. Application At Site Should Bedone Asper Manufacturerguidelines. Any Report Submittalwithinstallationpicturesshouldbedoneusingcfs-Dmsoftware, Whichshallbecharged Extra. Anchor Hvu2+ Has U M20x170 1700 Suppling, Drilling / Cleaningholeandfixing Makeheavydutyetaapproved Chemicalanchorof Appropriate Size And Fixing Plates Subsequently. Anchor Comprises Of Hvu-2 Flexible Foil Capsule That Containsstyrenefreeurethanemethacrylateresin, Hardener, Quartz, Sand / Corundumandhas-U Threaded Rod Of Minimum 5.8 Steel Grade, Galvanized To Minimum 5 Microns. Anchor Should Be Approved For Cracked Concrete, Seismic & Diamond Drill Holes. Manufacture Should Submit Anchor Design Report Basedondesignloads&Otherparametersasprovidedbyconsultants.Chemicalanchorsshouldbe Designed In Accordance With Eota-Tr-029?Guidelinesfor Anchorage Of Chemical Anchorsfor Usein Concrete?For Approval. Application At Site Should Bedone Asper Manufacturerguidelines. Any Report Submittalwithinstallationpicturesshouldbedoneusingcfs-Dmsoftware, Whichshallbecharged Extra. Anchor Hvu2+ Has U M24x300 1701 Suppling, Drilling / Cleaningholeandfixing Makeheavydutyetaapproved Chemicalanchorof Appropriate Size And Fixing Plates Subsequently. Anchor Comprises Of Hvu-2 Flexible Foil Capsule That Containsstyrenefreeurethanemethacrylateresin, Hardener, Quartz, Sand / Corundumandhas-U Threaded Rod Of Minimum 5.8 Steel Grade, Galvanized To Minimum 5 Microns. Anchor Should Be Approved For Cracked Concrete, Seismic & Diamond Drill Holes. Manufacture Should Submit Anchor Design Report Basedondesignloads&Otherparametersasprovidedbyconsultants.Chemicalanchorsshouldbe Designed In Accordance With Eota-Tr-029?Guidelinesfor Anchorage Of Chemical Anchorsfor Usein Concrete?For Approval. Application At Site Should Bedone Asper Manufacturerguidelines. Any Report Submittalwithinstallationpicturesshouldbedoneusingcfs-Dmsoftware, Whichshallbecharged Extra. Anchor Hvu2+ Has U M30 X 270 1702 Acousticalwoodwoolwallpanelling:Providing&Fixingof100%Naturalmaterial-Magnesite ( Hygroscopic& Biologically Soundbinding Agent ) Bondedwoodwool Heradesignplanks Of 600Mm*1200Mm*25Mmthickness Madeout Of Wood Wool Fibre Of Width 1Mm Fiber Thickness Mixed With Natural Water & Magnesite ( No-Cement ) With Open & Smooth Surface Texture, Weight Of Panel To Be 11.3 Kg / M2.A Completly Harmless Envirenment & Human Friendly & Also A Disposable Or Recyclable Material &Canlastformorethan80yearsinbuildinginteriorsasithaslonglifespan&Suitableforindoorconditionswithrelativeair Humidity Of Upto 90%. Magnesite Protects The Wood Cells Against Ageing & Fungal Attack. To Achive Upto Nrc=1.00 It Should Be A Clear Gapof 200Mmfromwall Slabalong Withthe Backing Of Mineral Wool Of 50Mmthickwith64kg / M3density. Ecologically Sound Material With High Mechanical Strength With Crash Test Of 90Km / H With Ball Impact Test Din18032 & En13964 With Flying Colors & Asustainablematerial ( Pefc&Fsccertified ) Alongwithepdcertifiedacc.Toeniso14025 ( Aub-Envirenmentalproduct Declaration ) . Manufacturing Tolerance For Nominal Size: Length, Width & Thickness ± 1 Mm, & In A Standard Climate Of23° C And 50% Rel. Humidity. Fixing & Substructure: Impact Resitant According To Din-18023 Or En13964 To Be Fixed On Cd Sections Profileframeworkwithscrew9pc / Panel&Centredistancesupportof300mm&Centredistanceofcrossprofilewouldbeat 600Mm&Mainprofileat900mmcdprofileismadeoutofgi ( Sectionsprofile60 / 27 / 0.6Mm-0.6Mmthickx60mmwidthx 0.27Mm Height ) . The Main Profile Is In The Legth Of 3000Mm & To Form A Section Of 600Mm X 1200Mm. Heradesign Superfine Panels To Be Fixed On The Wall With A Minimum Of 200Mm Void Or Gap With Galvanized Screws Of Length 50Mm & Dia 4.5Mm With A Backing Of Mineral Wool Of Density 64Kg / M3density ( 50Mmthick ) .Colourof Panels: Natural Beige, Canbepaintedtothedesired Colour ( Any- Ral, Ncs Or Stocolor Shades ) Using Water Based Color By Spray Method Prior To Installation. Fire Class As Per En 13501-1:B –S1, D0. Test Certificates To Be Submitted. 1703 Acousticalwoodwoolfalseceiling:Providing&Fixingof100%Naturalmaterial-Magnesite ( Hygroscopic& Biologically Soundbinding Agent ) Bondedwoodwool Heradesignplanks Of 600Mm*1200Mm*25Mmthickness Madeout Of Wood Wool Fiber Of Width 1Mm Fiber Thickness Mixed With Natural Water & Magnesite ( No-Cement ) With Open & Smooth Surface Texture, Weight Of Panel To Be 11.3 Kg / M2.A Completely Harmless Environment & Human Friendly & Also A Disposable Or Recyclable Material &Canlastformorethan80yearsinbuildinginteriorsasithaslonglifespan&Suitableforindoorconditionswithrelativeair Humidity Of Upto 90%. Magnesite Protects The Wood Cells Against Ageing & Fungal Attack. To Achieve Upto Nrc=1.00 It Should Be A Clear Gap Of 200Mm From Wall Slab Along With The Backing Of Mineral Wool Of 50Mm Thick With 64 Kg / M3 Density. Ecologically Sound Material With High Mechanical Strength With Crash Test Of 90Km / H With Ball Impact Test Din18032 & En13964 With Flying Colors & Asustainablematerial ( Pefc&Fsccertified ) Alongwithepdcertifiedacc.Toeniso14025 ( Aub-Environmentalproduct Declaration ) . Manufacturing Tolerance For Nominal Size: Length, Width & Thickness ± 1 Mm, & In A Standard Climate Of23° C And 50% Rel. Humidity. Fixing & Substructure: Impact Resistant According To Din-18023 Or En13964 To Be Fixed On Cd Sections Profileframeworkwithscrew9pc / Panel&Centredistancesupportof300mm&Centredistanceofcrossprofilewouldbeat 600Mm&Mainprofileat900mmcdprofileismadeoutofgi ( Sectionsprofile60 / 27 / 0.6Mm-0.6Mmthickx60mmwidthx 0.27Mm Height ) . The Main Profile Is In The Length Of 3000Mm & To Form A Section Of 600Mm X 1200Mm. The Cd Profile Is To Be Suspended From Soffit With The Help Of Nonius Hanger At A Center Distance Of 900Mm. Ud Profile 28 / 27 / 0.6Mm To Be Fixed On Wall At The Perimeter Of The Wall. If The Main Cd Profile Needs To Extended, It Needs To Be Connected With Cd Profile Connector 60 / 27. The Cd Profiles To Be Connected To Each Other At The Intersection By Cd Cross Connector. Heradesign Superfine Panels To Be Fixed To The Ceiling With A Minimum Of 200Mm Void Or Gap With Galvanized Screws Of Length 50Mm & Dia 4.5Mm With A Backing Of Mineral Wool Of Density 64Kg / M3 Density ( 50Mm Thick ) . Colour Pf Panels : Natural Beige, Can Be Painted To The Desired Colour ( Any- Ral, Ncs Or Stocolor Shades ) Using Water Based Color By Spray Method Prior To Installation. Fire Class As Per En 13501-1:B–S1, D0. Test Certificates To Be Submitted. 1704 Metalfalseceilingwithoutsuspensionsupportfromtrueceiling:Providing&Fixinghorizontallevel Suspended Metal Ceilings Comprising Of Metalworks F-H 600 Hook-On Corridor System Manufactured By Armstrong Ceiling Solutions Withrectangularpanelsmadeof0.7Mmthickgalvanisedsteel ( Gi ) Of120gsm, Postcoatedtoglobal Whitecolour, Suitablefor Interior Applications And Architectural Finishes, Double Grid Concealed System And Butt Joint Panels. The Panel Width Shall Be 300Mm, Length Ranging From 1500Mm To 2660Mm. General Specifications:Entire System To Be Designed For Interior Applications, And Concealed Grid, Butt Joint Panels. Panel Specifications: Material: The F-H 600 Rectangular Hook-On Panels To Be Made Of Galvanized Steel ( Gi ) Of Minimum 120Gsm Hot Dipped Galvanization ( Both Sides Included ) As Per Is 277 ( 2003 ) , Zero Or Minimum Spangled, In Minimum Base Material Thickness Of 0.7Mm As Per In Is:513 ( 1994 ) . Dimensions: The Panel Length Varies Between 1500Mm To 2660Mm, Panel Width Shallbe300mm.Thedimensionaltolerancesforlengthshallbe±1.0Mupto1000mml;±1.5Mmbetween1001to2000mml;±2.0Mm Between 2001 To 3000Mm L. The Dimensional Tolerances For Width Shall Be ±0.5M Up To 300Mm W. Dimensional Tolerances For Panel Thickness / Panel Width / Panel Length - To Be Measured In Accordance With Taim Standards. Edge Detail: The Panels Shall Ha+A3ve Square Edge, With A 3Mm ( W ) X 8Mm ( H ) Black Foam Gasket Glued At The Edges, Typically On One Long And One Short Side. All Adjacent Panels Shall Touch Each Other Forming A Butt Joint And Concealed Grid Visuals. Upturns: The Short Side Of The Panel Shall Have Vertical Upturnsof Minimum30mm ( H ) And Shall Be Bent Appropriately Bent As Per Themanufacturer‘Sspecifications For Providing Hook-On Ends. The Long Side Shall Have Inside Horizontal Bends Of 5-15Mm For Rigidity And Vertical Upturns Of 40Mm ( For Length Ranging From 1251-2660Mm ) . Surface Finish: Plain: The Panels Shall Be Inplain Unperforatedfinish ( Without Any Acoustical Backing / Felt ) . Colour And Finishes: The Panel Surface Shall Be Electrostatically Powder Coated ( Post Coat ) On Visible Side After Mechanical Production, Using Rohs Compliant Powder, To Achieve Coating Thickness Ranging From 60-80? And Architectural Quality Finish. The Powder Coating Shall Pass Salt Spray Test For 750 Hours As Per Astm B117, Quv–Atest For 1000Hours As Per Astm G-154– ( Cycle–1 ) And Humidity Test For 1000Hours As Per Din 50017, 250 Hours Of Condensation Test ( As Per Din 50017 Or Din En Iso 6270-1 Norms ) , Uv Resistance Of 500 Hours And 50% Gloss Retention ( As Per Astm G 154 Uvb-313 Norms ) . The Powder Coating Shall Have An Adhesion Of Gt0 As Per En Iso 2409. The Shade Variation Across Batches Shall Be Delta E ( ?E ) <1 Measured Using Excite / Byk Gardner Instrument And Gloss Level Of 25±5% At60°As Per Astm D523.The Colour / Shade To Be Global White ( Polyester For Interior ) As Approved By The Architect Or Engineer-In-Charge. Surface Protection: The Visible Panel Surface Shall Be Protected Using A Guard Film Made Of Ldpe Of 50? Thickness, Having Appropriate Surface Adhesion ( Or Tackiness ) Corresponding To Surface Gloss Level. Light Reflectance: The Panel Shall Have A Light Reflectance Of=63% In Accordance To Astm 1477-98. Flatness And Sag Limit: Panels Shall Be Flattened By Precision Leveller To Minimize Sag To Less Than Length / 400Mm. The Difference Between The Two Diagonal Dimensions Of The Panel To Be Less Than 1Mm. The Sag To Be Measured At The Center In Accordance With Taim Standards. Access And Plenum Space: The Panels To Be Fully Accessible, With System Height Of 98Mm, And Would Require A Plenum Height Of A Minimum450mm Clear Space From Bare Ceiling / Rigid Structure For Installation. Packaging: The Panels Shall Be Packed In Wooden Crates Of Appropriate Dimensions Based On Panel Sizes.The Wooden Planks For Rates Shall Have Thickness Of Approx.15Mm, Width Of Around4?And Gap Between Two Planks Around3?.Crates To Have Layer Separators Of1?X2?Dimensions To Prohibit Load Transfer On Bottom Panels, And The Crates Lifting To Be 2Way Or 4Way. Thebottom Of Crates Shall Be Completely Closed, And The Panels Kept Inside Shall Have Cushioning Of Corrugated Sheets Or Other Appropriate Material. Installation Specifications: Primary And Secondary Runners Installation: U-Profiles, Spaced At 1200Mm, To Be Suspended From Ceiling Using Clamping Brackets And Threaded Rods Or Hanger Wires. Hanger Wires Must Be Wrapped Tightly With 3 Full Wraps. The J-Bars ( Directional ) Shall Intersect The U-Profile At 90° At Every Module Dictated By The Panel Length. The J-Bar Is Connected To The U- 1705 Metal Baffle Ceiling : Providing & Fixing Of Horizontal Level Suspended Ceiling Comprising Of Vertical Linear Baffle Ceiling Made Out Of Aluminum Extrusion In Aluminum Alloy Grade 6063 T5. The Baffle Blade Shall Be In Size Of 100X25x3600mm In Powder Coated To Woodgrain / Plain Finish ( Red Oak, Cherry, Black & White ) .. The Baffle Shall Be Electrostatically Polyester Powder Coated To A Coating Thickness Of 60-80 Micron. The Powder Coating Shall Pass Salt Spray Test For 750 Hours As Per Astm B117, Quv–Atest For 1000Hours As Per Astm G-154– ( Cycle–1 ) And Humidity Test For 1000Hours As Per Din 50017. The Powder Coating Shall Have An Adhesion Of Gt0 As Per En Iso 2409. The Shade Variation Within A Manufacturing Batch Shall Be Delta E<1 Using Excite / Byk Gardner Instrument And Gloss Level 25±5 At60°As Per Astm D523 ( Not Applicable Of Wood Grain Shade ) . The Baffle Blade Shall Be Suspended Using Slotted U-Profile Of 20 X 30 X 3700Mm ( Thk-1.5Mm ) Having Slots In Module Of 25Mm To Keep Baffles At An On-Center Spacing In Multiples Of 25Mm. Longer Lengths Of Baffle To Be Connected By Baffle Joiner And The Ends To Be Fixed With End Caps..Suspension: Shall Be Hanged Using Baffle Hanger From U-Profile Made Of Mild Steel With Powder Coating Thickness Of 60-80 Micron. The U–Profile To Comprise Of Alternate Square & Rectangular Slots Of 6.5X6.5Mm & 28X6.5Mm Respectively On The Web For Locking The Baffle Hanger Using Plugin Clip To Secure The Hanger In Perfect Position And Achieve Uniform Spacing Between Baffles. The Overall Dimension Of The U–Profile Is 20 ( W ) X 30 ( H ) X 3750 ( L ) Mmandisrolledformfrom1.5Mmthickmildsteel Witha Powdercoating Thicknessof 60- 80Micron. U- Profile To Be Connected To Each Other Using U–Profilesplice. The U- Profile Shall Be Hanged From The True Ceiling Using Threaded Rod Using A U- Profile Hanger.The Baffle Along With Suspension System Used Together Shall Carry A 10 Year Warranty Against Manufacturing Defect And Manufacturer Shall Provide A Warranty Certificate. The Supply Shall Be Backed By A Manufacturing Test Certificate. Installation:Installation Of U-Grid:The U Profile To Be Suspended At Every 1200Mm Center To Center Using 6Mm Threaded Rod From The Structural Soffit Using U-Profile Hanger. U-Profile Splice To Be Used To Join More Than One U Profiles Of Length 3.7M. 1St U-Grid Channel Must Be No More Than 400Mm From The Perimeter.Installation Of Baffles:Locate The Slot For Baffle Hangers In U Profile Section At 1200Mm Centers. Hangers Are Inserted Into The Slot, Then Rotated 90° And Fixed Intopositionbytighteningthegrubscrew.Baffletobeliftedintopositionandhangersengageoverlipofu-Gridchannel.Each Hanger To Be Secured Into Position By Inserting The Locking Clip.When Doing Continuous Installation, Baffles Blades Are To Be Connected At Ends With Baffle Joiner, Which Are Inserted Into The Top And Bottom Slots Of The Baffle Closed Profile For Alignment Only. The Bottom Joiner To Be Located First And Fastened On One Side Only. The Top Joiner To Be Fitted Then And Secured With Grub Screws On One Side. Then The Two Baffle Sections Shall Be Joined And The Top Joiner Is Screw Fastened On The 2Nd Baffle Profile.End Caps To Be Located By Pushing The End Cap Tongues Into Open Baffle Slots. Installation Should Be Carried Out As Per Manufacturer Recommended Procedure. 1706 Metal Opencell Ceiling: Providing&Fixinghorizontal Level Opencell Aluminiumlay-Inceiling Tileswithborderpanels Formingboardedgeof Size600x600x38mm ( Nominal ) Havingcell Sizeof 100X100mmmadeofaa-3003-H14 ( Tempered ) Grade Aluminiumsuitable For Architectural Finishes In 0.35Mm Thickness As Per In Is:2676 ( 1981 ) In Global White Color. The Tile Shall Be Electrostatically Polyester Powdercoatedusing Rohs Compliant Powder Having Coating Thickness Ranging From60-80 Microns.The Powder Coating Shall Pass Salt Spray Test For 750 Hours As Per Astm B117, Quv–Atest For 1000 Hours As Per Astm G-154– ( Cycle–1 ) And Humidity Test For 1000 Hours As Per Din 50017. The Powder Coating Shall Have An Adhesion Of Gt0 As Per En Iso 2409. The Shade Variation Across Batches Shall Be Delta E<1 Using Excite / Byk Gardner Instrument And Gloss Level Of 25±5% At60°As Per Astm D523. Tile Shall Have A Fire Performance Class A As Per Gb 8624-2012. Suspension: The Tile Shall Be Laid On 15 Mm Wide T - Section Flanges Colour Global White ( Matching To Tile Colour ) Having Double Stroke Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm & 600 Mm Cross Tees With A Web Height Of 38Mm ( All Sections ) . The Deflection Loading Of The System Shall Be12.5 Kg / M2 ( As Per Standard Installation Layout Mentioned Below ) And Main Beam Tested As Per Astm C635 ( Deflection Limit Less Than L / 360 ) With A Deflection Loading Of 15Kg / M. The End Details Of The Cross Tee Shall Be Made Of Pre Hardened Steel Clip Fixed To The Ends Of The Cross Tee To Provide Double Locking Between?Crosstee To Crosstee?And?Crosstee To Mainbeam?.All Main Beam To Main Beam And Crossteetocrossteeconnectionshallhaveapulloutstrengthofmorethan100kg.Thetsectionsshallbemadeofhotdipped Galvanized Steel 90 Gsm And Pre-Painted Steel With Baked Polyester Paint Of 0T Bending Capability.The Tile & Grid System Used Together Shall Carry A 10 Year Warranty Against Manufacturing Defect And Manufacturer Shall Provide A Warranty Certificate.Thetile&Gridshall Havethemanufacturersnameembossed / Printedonit.Thesupply Shall Bebackedby A Manufacturing Test Certificate. Installation: To Comprise Main Runner Spaced At 1200Mm Securely Fixed To The Structural Soffit Using Suspensionsystem ( Specificationsbelow ) At1200mmmaximum.Thefirst / Last Suspensionsystemattheendof Eachmain Runner Shall Not Be Greater Than 450Mm From The Adjacent Wall Along With The First And The Last Main Beam Shall Be At Less Than 600Mm From The Wall.Flush Fitting 1200Mm Long Cross Tees To Be Interlocked Between Main Runners At 600Mm To Form 1200 X 600 Mm Module.Cut Cross Tees Longer Than 600Mm Require Independent Support. 600 X 600Mm Module To Be Formed By Fitting 600Mm Long Flush Fitting Cross Tees Centrally Between The 1200 Mm Cross Tees.Perimetertrimto Bewall Angles Of Size 3000X19x19mm, Securedto Walls Using Screws At 450Mmcentre To Centre Maximum. All Border Cut Tiles Shall Be Laid, Usinglay-In End Cap For Installation To Have A Microlook Effect On Perimeters.Installation Shall Be Carried Out As Per Manufacturer Recommended Procedure.Suspension System Accessories Manufacturedand Suppliedby Manufacturerconsisting Of M6 Anchorfasteners Withhanger Hole, Pre Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413 Mpa And A Minimum Loading Strength Of 110 Kgs. Additionally, Adjustable Hook Clips Made Of 0.7Mm Thick Grade 1 C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main Runners. 1707 Acoustical Glass Fibrefalse Ceiling Blades : Providing And Fixing Acoustical Blade Which Are 40 Mm Thick, Flat Glass Fibre Panelswith Humidity Resistance Rh 90%, With Factory Fitted Embedded Metal Insert With¼?–20 Threading For Fixing Cable Adjusterforhangingapplication.Acousticalbladesshallhavesizesof 200X1200mm, 200X1600mm, 400X1200mm, 400X1600mm, 400X1800mm, 500X1200mm Or 500X1600mm With Both Side Laminated Scrim Finished With Uniform Water Based Paint On All Surface ( Including Edges ) . Acoustical Performance Of 0.65 Nrc ( For 400Mm High X 40Mm Thick Baffles With 400Mm On Centre Distance And Overall Depth Of Construction 1000Mm ) As Per Astm C-423 ( Average Value Of Absorption Co-Efficient Readings Taken At 250 Hz, 500 Hz, 1000Hzand2000hz ) Instandardwhitecolorwithlightreflectance87%Orinthecolorspecifiedby Thearchitect ( Shell / Tangerine / Cranberry / Moss / Kiwi / Reef / Lagoon ) , Fire Performance Class B2–S1, D0 As Per En 13501-1 .The Blade Shall Be Made Of Glass Fibre Panel With Density Of 110-120 Kg / M3. Suspension: The Panel Shall Be Hung Using Hanging Kit Comprising Of Griper Structure Anchor & Cap Of Dia 20Mm, Spring Loaded Bottom End Cable Adjuster Of Dia. 9Mm And 2.4M Long Aircraft Cable Of1 / 16? Dia.The Blade Along With Suspension System Shall Carry A 1 Year Warranty Against Manufacturing Defect And Manufacturer Shall Provide A Warranty Certificate. The Supply Shall Be Backed By A Manufacturing Test Certificate.Suspension System Detailscomponents 1 ) Griperstructure Anchor2 ) Gripperanchorcap3 ) Cableadjuster4 ) Aircraftcablecableadjusterspringloaded Bottom End Cable Adjuster Of Dia. 9Mm And 45Mm Long Aircraft Cable Material Galvanized Steel Aircraft Cable Dimension1 / 16?Ø X 2.4M Tolerance ±1Mm. Installation:Hangerwireattachmenttostructure:Attachthegripperstructureanchortothestructurewithanappropriatefastener ( 1 / 4-20 Threading ) That Will Carry The Full Weight Of The Blades. Insert The End Of The Cable Into The Gripper Anchor Cap. Screw The Gripper Anchor Cap Completely Into The Gripper Structure Anchor.Insert Suspension Cables:The Panel Is To Be Suspended Using The Aircraft Cables Which Are Suspended From The Soffit Using The Gripper Structure Anchors And Its Other End Passing Through The Bottom End Cable Adjuster. The Height & Level Of The Panels Can Be Adjusted Using The Bottom End Cable Adjusters.Suspension Of Blade: Locate The Two Factory Fitted Female Inserts On The Blades. Suspend The Blades By Screwing The Bottom End Of The Cable Adjuster Into The Female Inserts.Installation Should Be Carried Out As Per Manufacturer Recommended Procedure. 1708 Acousticalglassfibre Falseceilingclouds&Shapes:Providingandfixingacousticalclouds / Shapes- Acoustical Clouds Which Are 30Mmthick, Flat Glass Fibre Panels Of Humidity Resistancerh 95%, With Embeddedframe Made Of Aluminium Extruded Section Of38x10mm Of Grade 6063-T6 As Per Dimension Mentioned In Below Table For Reinforcement And Secured Hanging. Embedded Extrusion Shall Have Grub Slot With Pre Inserted Nut For Group Hanging And Connected Using Aluminium Die Casted Cornerconnectorwith¼?–20Threadingforhangingusingcableadjusterforindependentclouds.Theformofacoustical Clouds / Shapes - Shall Be Square / Convex / Concave / Circle / Hexagon / Trapezoid / Parallelogram ( Left & Right ) / Rectangle ( Small & Large ) In Standard Traffic White Color With Light Reflectance 90% As Per Astm 1477-98 Or In The Color Specified By The Architect / Engineer In Charge ( Shell / Tangerine / Cranberry / Moss / Kiwi / Reef / Lagoon ) . The Acoustical Clouds / Shapes Shall Be Made Of Glass Fibre Panel With Density Of 110-120 Kgs / M3 Along With Acoustical Sound Absorbing Scrim On The Face To Achieve Sound Absorption As Per Belowmentionedtableinaccordancetoeniso354:2003 ( Averageof 500-4000Hz ) .Thefaceandedgesshallbefinishedwith Matching Water Based Texture Paint. Shape Nominal Size And Sound Absorption – Metric Sabin1. Square 1170X1170mm- 2.48 Metric Sabin 2. Convex 1170X1140mm2.28 Metric Sabin 3. Concave 1170X1140mm 1.94 Metric Sabin 4. Circle 1170 Dia. 2.12 Metric Sabin 5. Hexagon 1170X1010mm 1.61 Metric Sabin 6. Trapezoid 1170X1170mm 2.15 Metric Sabin 7. Left Parallelogram 1170X1170mm 2.15 Metric Sabin 8. Right Parallelogram 1170X1170mm 2.15 Metric Sabin.The Panel Shall Behungasperthefollowingbasedontheinstallation.Individualsuspension-Thepanelshallbehungusingdeckhangingkit Comprising Of Griper Structure Anchor & Cap Of Dia. 20Mm, Spring Loaded Bottom End Cable Adjuster Of Dia. 9Mm And 2.4M Long Aircraft Cable Of1 / 16? Dia. The Number Of Deck Hanger Will Be As Per Table 1 Above.The Acoustical Clouds / Shapes Shall Carry A 1 Year Warranty Against Manufacturing Defect And Supported By A Manufacturer Warranty Certificate. The Supply Shall Be Backed By A Manufacturing Test Certificate.Suspension System Details Components1 ) Griper Structure Anchor, 2 ) Gripper Anchor Cap 3 ) Cable Adjuster 4 ) Aircraft Cable Cable Adjuster Spring Loaded Bottom End Cable Adjuster Of Dia. 9Mm And 45Mm Long Aircraft Cable Material Galvanized Steel Aircraft Cable Dimension 1 / 16?Ø X 2.4M Tolerance ±1Mm Installation:Individual Suspension.The Panels To Be Suspended Individually Using The Acoustical Clouds / Shapes Deck Hanging Kit As Per The Number Specified In Above Table 1.Hanger Wire Attachment To Structure: Attachthe Gripper Structure Anchorto The True Ceiling Using Anappropriate Fastener ( 1 / 4-20 Threading ) That Will Carry The Full Weight Of The Panels. Insert The End Of The Cable Into The Gripper Anchor Cap. Screw The Gripper Anchor Cap Completely Into The Gripper Structure Anchor.The Panel To Be Suspended Using The Aircraft Cablesfrom The Soffit By Fixing The Cap End Of The Cable Togripper Structure Anchors And Theother End Passing Through The Bottom End Cable Adjuster. The Height & Level Of The Panels Can Be Adjusted Using The Bottom End Cable Adjusters.Suspendtheacousticalclouds / Shapesbylocatingandscrewingthebottomendofthecableadjusterintothethreadingofthe Connector. 1709 Customprintedacoustical Falseceiling:Providing&Fixingofcustomcolorprintedmineralfibreacoustical Suspended Ceiling System With 19Mm Thick Microlook 90 Edge Tiles With 15Mm Face Exposed Grid. The Tiles Shall Have Smooth Bright Laminated Visual With Humidity Resistance ( Rh ) Of 99%, Nrc 0.7 ( Average Value Of Absorption Co-Efficient Readings Taken At 250 Hz, 500Hz, 1000Hz And2000hz ) As Per Astm C423standard, Cac Of 41Dbas Perastm E1414, Light Reflectance=87%As Per Astm E-1477, Thermal Conductivity K = 0.045 - 0.048 W / Mk, Colour Global White, Fire Performance Of Class 0 / 1 As Per Bs 476 Part6 / 7Andclassa Asperastme84with19mmsquaretegular / Microlook90°Edgeand8mmdropinmodulesizeof 600X 600Mm. The Scrim On The Face Of The Tile Shall Be Cleanable, Soil And Scratch Resistant And Having Superior Scrub-Ability ( Gardner Test ) . Thetilesshallbeclassifiedasiso14644-1Cleanroomclass5.Thetileshallhavearatingof8orabovefortestsconductedfor Resistance To Growth Of Mold In Accordance To Astm D3273. It Shall Be Suitable For Green Building Application, With Recycled Content Of 36%. The Tile Shall Have Certifications From Griha And Greenpro Thereby Confirming That It Is An Environment Friendly Product. Suspension: The Tile Shall Be Laid On With 15 Mm Wide T - Section Flanges Colour Global White ( Matching To Tile Color ) Having Roll Formed Double Stroke Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm & 600 Mm Cross Tees With A Web Height Of 38Mm ( All Sections ) . The Deflection Loading Of The System Shall Be 12.5 Kg / M2 ( As Per Standard Installation Layout Mentioned Below ) And Main Beam Tested As Per Astm C635 ( Deflection Limit Less Than L / 360 ) With A Deflection Loading Of 15Kg / M. The End Details Of The Cross Tee Shall Be Made Of Pre Hardened Steel And Fixed To The Ends Of The Cross Tee To Provide Double Locking Between?Crosstee To Cross Tee?And?Crosstee To Mainbeam?.All Main Beam To Main Beam And Cross Tee To Cross Tee Connection Shall Have A Pull Out Strength Of More Than 100Kg. The T Sections Shall Be Made Of Hot Dipped Galvanized Steel Of 90 Gsm As Per Is 277 ( 2003 ) And Pre-Painted Steel Withbakedpolyesterpaintwith0tbendingcapability.Allbordercrosstee / Mainbeamshallbelevelledusingperimeterfill. Installation:Tocomprisemainrunnerspacedat1200mmsecurelyfixedtothestructuralsoffitusingsuspensionsystem ( Specifications Above ) At 1200Mm Maximum. The First / Last Suspension System At The End Of Each Main Runner Shall Not Be Greater Than 450Mm From The Adjacent Wall Along With The First And The Last Main Beam Shall Be At Less Than 600Mm From The Wall. Flush Fitting 1200Mm Long Cross Tees To Be Interlocked Between Main Runners At 600Mm To Form 1200 X 600 Mm Module.Cut Cross Tees Longer Than 600Mm Require Independent Support. 600 X 600Mm Module To Be Formed By Fitting 600Mm Long Flush Fitting Cross Tees Centrally Between The 1200 Mm Cross Tees. Perimeter Trim To Be Wall Angles Of Size 3000X19x19mm, Secured To Walls Using Screws At 450Mm Centre To Centre Maximum.Installation Shall Be Carried Out As Per Manufacturer Recommended Procedure.Suspension System Accessories Supplied By Manufacturer Consisting Of M6 Anchor Fasteners With Hanger Hole, Pre-Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413 Mpa And A Minimum Loading Strength Of 110 Kgs. ( Optionally, Adjustable Hook Clips Made Of 0.7Mm Thick Grade 1 C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main Runners ) .. 1710 Prividingandfixingmetal Wall Panelling: W-H1100hook-Onwall Claddingsystemmanufacturedby Armstrong Ceiling Solutions With Rectangular Panels Made Of 1.0Mm Thick Galvanised Steel ( Gi ) Of 120Gsm, Post Coated To Wood Grain Finish, Suitable For Interior Applications And Architectural Finishes, Wall Mounted Concealed Grid System And Butt Joint Panels. The Panel Width Shall Be 495Mm, Length Ranging From 300Mm To 1195Mm.General Specifications: Entiresystemtobedesignedinaccordancewithen13964andtaime.V.Qualityguidelinessuitablefor Green Building Application For Interior Applications, Andconcealed Grid, Butt Joint Panels.Panel Specifications: Material: The W-H 1100Rectangularhook-Onpanelstobemadeofgalvanizedsteel ( Gi ) Ofminimum120gsmhotdippedgalvanization ( Bothsides Included ) As Per Is 277 ( 2003 ) , Zero Or Minimum Spangled, In Minimum Base Material Thickness Of 1.0Mm As Per In Is:513 ( 1994 ) Dimensions: The Panel Length Varies Between 300Mm To 1195Mm, Panel Width Is 495Mm. The Dimensional Tolerances For Length Shall Be±1.0Mupto1000mml;±2.0Mmbetween1001to2000mml;.Thedimensionaltolerancesforwidthshallbe±0.75Mupto 600Mmw;.Dimensional Tolerancesforpanel Thickness / Panel Width / Panel Length- Tobemeasuredinaccordance Withtaim Standards. Edge Detail: The Panels Shall Have Square Edge, With A 5Mm ( W ) X 8Mm ( H ) Black Foam Gasket Glued At The Edges, Typically On One Long And One Short Side. All Adjacent Panels Shall Touch Each Other Forming A Butt Joint And Concealed Grid Visuals. Upturns: The Hook Side Of The Panel Shall Have Vertical Upturns Of Minimum 30Mm ( H ) And Shall Be Bent Appropriately Bent As Per Themanufacturer‘S Specifications For Providing Hook-On Ends. The Long Side Shall Have Inside Horizontal Bends Of Around 10Mm For Rigidity And Vertical Upturnsof 30Mm.Surface Finish: Plain / Perforated: The Panels Shall Be Inplainor Perforatedfinishwithacoustical Backing / Felt. Colour And Finishes: The Panel Surface Shall Be Electrostatically Powder Coated ( Post Coat ) On Visible Side After Mechanical Production, Using Rohs Compliant Powder, To Achieve Coating Thickness Ranging From 60-100? And Architectural Quality Finish. The Shade Variation Across Batches Shall Be Delta E ( ?E ) <1 Measured Using Excite / Byk Gardner Instrument And Gloss Level Of 25±5% At60°As Per Astm D523. The Shade To Be White Or Std Wood Grain As Approved By The Architect Or Engineer-In-Charge. Surface Protection: The Visible Panel Surface Shall Be Protected Using A Guard Film Made Of Ldpe Of 50? Thickness, Having Appropriate Surface Adhesion ( Or Tackiness ) Corresponding To Surface Gloss Level. Flatness And Sag Limit: Panels Shall Be Flattened By Precision Leveller To Minimize Sag To Less Than Length / 400Mm. The Difference Between The Two Diagonal Dimensions Of The Panel To Be Less Than 1Mm. The Sag To Be Measured At The Centerinaccordancewithtaimstandards.Accessspace: Thepanelstobeprogressively Accessible, Withsystemdepthof 60Mm ( +17Mm / -8Mm ) And Would Require A Plain Flat Vertical Clear Rigid Wall / Structure For Installation Of The Grid System With Appropriate Depth An Clear Space. Packaging: The Panels Shall Be Packed In Wooden Crates Of Appropriate Dimensions Based On Panel Sizes. The Wooden Planks Shall Have Thickness Of Approx.15Mm, Width Of Around4?And Gap Between Two Planks Around3?.Crates To Have Layer Separators Of1?X2?Dimensions To Prohibit Load Transfer On Bottom Panels, And The Crates Lifting To Be 2Way Or 4Way. The Bottom Of Crates Shall Be Completely Closed, And The Panels Kept Inside Shall Have Cushioning Of Corrugated Sheets Or Other Appropriate Material.Suspension System Specifications:Grids: Primary Runners Would Be Gi U-Wall Profile ( Minimum Galvanization 120Gsm ) Of 50Mm ( W ) X 2400Mm ( L ) X 24Mm ( D ) X 1.5Mm ( T ) , Machine Formed Slotted Profile.Accessories: Accessories Wouldinclude Connector For U-Wall Profile ( Gi ) , Suspending Elementfor U-Wall Profile ( Gi ) , Supporting Bracket ( Rubber ) , Wall Anchor For U-Wall Profile ( Gi ) , Corner Wall Anchor For U-Wall Profile ( Gi ) .Wall Anchor For C-Wall Profileminimum 1.25Mm Thick, Galvanization 120 Gsmsuspending Elementminimum 1.2Mm Thick, Galvanization 120 Gsm 1711 Prividing And Fixing Modular Acouctical Wooden Wall Panelling: Of Nominal Width 100 / 150Mm, Having80mmwidepanelwith20mmrevealhavingathicknessof15mmthicknessandlength2400mm.Thepanelshallbemadeofa Moisture Resistant Fibre Board Substrate Having A Minimum Density Of 595 Kg / M3 With A Laminated Facing As Per The Approved Shade ( Portland Maple, Sea Beech, Siam Wood & Mystique Walnut ) And A Melamine Balancing Layer On The Reverse Side. The Panel Shall Have 0.7Mm Pvc Edge Banding Along The Length Side With A Similar Finish As That Of The Face. The Back Of The Panel Shall Have A Black Acoustic Felt To Cover The Reveal Of 20Mm To Attain An Nrc Of 0.4 For 150Mm. / 0.5 For 100Mm. Module ( Average Value Of Absorption Co-Efficientreadingstakenat250hz, 500Hz, 1000Hzand2000hz ) Asperastmc423.Thepanelsshallprovideahumidity Resistance ( Rh ) Of 70% With Camber Limit Less Than 1Mm / 1000Mm And Bow Less Than 1Mm / 300Mm. The Back Of The Panels Shall Be Profile-Grooved To Receive 3600Mm Special Main Beam Carrier With Integrated Factory Fitted Clips For Installation. Suspension: The Panels Shall Be Upward Mounted On 24 Mm Wide T - Section Flanges Having Rotary Stitching Along The Length Of The Beam With A Web Height Of 43Mm. The Main Beam Shall Have Integrated ( Factory Fitted ) Locking Clips Installed At 100 / 150Mm Centre To Centre Distance. The Deflection Loading Of The Main Beam Tested As Per Astm C635 ( Deflection Limit Less Than L / 360 ) Shall Be At Least 21.4Kg / M. The End Details Of The Main Beam Shall Be Made Of Pre Hardened Steel And Fixed To The Ends With 3 Point Fixing. All Main Beam To Main Beam Connection Shall Have A Pull Out Strength Of More Than 100Kg. The T Sections Shall Be Made Of Hot Dipped Galvanized Steel Of 100 Gsm As Per Is 277 ( 2003 ) And Pre-Painted Steel With Baked Polyester Paint With 0T Bending Capability. Installation Should Be Carried Out As Per Manufacturer Recommended Procedure. The Grid Shall Be Installed With Suspension System Of Manufacturer Make.The Panel & Grid System Used Together Shall Carry A 1 Year Warranty Against Manufacturing Defect And Manufacturer Shall Provide A Warranty Certificate. The Panel & Grid Shall Have The Manufacturers Name Embossed / Printed On Itself. The Supply Shall Be Backed By A Manufacturer Test Certificate. Ceiling Installation:Perimeter Trim To Be Wall Angles Of Size 3000X19x19mm, Secured To Walls At 450 Mm Maximum Centre To Centre. Mount The Wall Angle Around Perimeter At Desired Height. Install The Main Beam With Factory Fitted Locking Clip At A Level 16Mm Above The Wall Angle Level. Mainbeamtobesupportedfromthestructurewith1stsuspensionnotmorethan300mmfromthewallanddistancebetween Suspensions To Be Less Than 900Mm Centre To Centre. Each Main Beam Are To Be Place At 600Mm Centre To Centre With The 1St Main Beam At Not More Than 100Mm From The Wall. Install The Panels One-By-One By Inserting The Profile-Groove At The Back Of The Panel In The Clips Fitted On The Main Beam. Use A Wood Splice Accessory Provided By Manufacturer To Join Planks. Continue Installing Rows Of Planks Till The Actual Length / Width Is Achieved. Place The Border Panels On The Wall Angles For A Finished Visual. Finish The Edges Using The Edge Banding Tape To Cover The Cut Edge Of The Panel Provided By Manufacturer.Suspension System Accessories Manufactured And Supplied By Manufacturer Consisting Of M6 Anchor Fasteners With Hanger Hole, Pre Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413Mpa Anda Minimumloading Strengthof 110 Kgs. Additionally, Adjustable Hook Clips Made Of 0.7Mm Thickgrade 1C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main Runners.Wallinstallation:Anappropriatevapourbarrier ( Byothers ) Shallbeapplied / Installedontheverticalsurfacebeforetheinstallationtoproperlysealagainstentryofanymoisture.Vapourbarrier ( Byothers ) Shallbeinstalledaspermanufacturer‘S 1712 Prividingandfixingantimicrobialacousticalfalseceiling:Bioguardmineralfibreacousticalsuspended Ceiling System With 19Mm Thick Acoustics Microlook 90 Edge Tiles With 15Mm Face Exposed Grid. The Tiles Shall Have Smooth Bright Laminated Visual With Humidity Resistance ( Rh ) Of 99%, Nrc 0.7 ( Average Value Of Absorption Co-Efficient Readings Taken At 250 Hz, 500Hz, 1000Hz And2000hz ) As Per Astm C423standard, Cac Of 41Dbas Perastm E1414, Light Reflectance=87%As Per Astm E-1477, Thermal Conductivity K = 0.052 - 0.057 W / Mk, Colour Global White, Fire Performance Of Class 0 / 1 As Per Bs 476 Part6 / 7Andclassa Asper Astme 84 With19mmsquare Tegular / Microlook90°Edgeand8mmdropinmodule Sizeof 600X 600Mm. / 600X1200mm.Thescrimonthefaceof Thetileshall Becleanable, Washableupto500cycleas Perastm D-4828And Resistant To Disinfectants. The Tile Shall Be Treated With Anti Microbial Coating On The Face Of The Tile To Achieve Cleanroom Classification Of Class 5 ( Class 100 ) As Per Iso 14644-1 And Suitable Forzone 4 Area Having Partical Emission Under Normal Conditions Of Iso 5, Decontamination Class Of Cp10 And Bacteriological Cleanliness Class B1 For Specific Strains As Per Nf S 90-35:2003The Tile Shall Have A Rating Of 8 Or Above ( Face ) For Tests Conducted For Resistance To Growth Of Mold In Accordance To Astm D3273.It Shall Be Suitableforgreenbuildingapplication, Withrecycledcontentof35%Havingvocandformaldehydeemissionratelessthan 0.1Mg / M2 / Hr.Thetileshallhavecertificationsfromgrihaandgreenprotherebyconfirmingthatitisanenvironmentfriendly Product. Suspension: The Tile Shall Be Laid On 15 Mm Wide T - Section Flanges Colour Global White ( Matching To Tile Color ) Having Roll Formed Double Stroke Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm & 600 Mm Cross Tees With A Web Height Of 38Mm ( All Sections ) . The Deflection Loading Of The System Shall Be 12.5 Kg / M2 ( As Per Standard Installation Layout Mentioned Below ) And Main Beam Tested As Per Astm C635 ( Deflection Limit Less Than L / 360 ) With A Deflection Loading Of 15Kg / M. The End Details Of The Cross Tee Shall Be Made Of Pre Hardened Steel And Fixed To The Ends Of The Cross Tee To Provide Double Locking Between?Crosstee To Cross Tee?And?Crosstee To Mainbeam?.All Main Beam To Main Beam And Cross Tee To Cross Tee Connection Shall Have A Pull Out Strength Of More Than 100Kg. The T Sections Shall Be Made Of Hot Dipped Galvanized Steel Of 90 Gsm As Per Is 277 ( 2003 ) And Pre-Painted Steel Withbakedpolyesterpaintwith0tbendingcapability.Allbordercrosstee / Mainbeamshallbelevelledusingperimeterfill. Installation:Tocomprisemainrunnerspacedat1200mmsecurelyfixedtothestructuralsoffitusingsuspensionsystem ( Specifications Above ) At 1200Mm Maximum. The First / Last Suspension System At The End Of Each Main Runner Shall Not Be Greater Than 450Mm From The Adjacent Wall Along With The First And The Last Main Beam Shall Be At Less Than 600Mm From The Wall.Flush Fitting 1200Mm Long Cross Tees To Be Interlocked Between Main Runners At 600Mm To Form 1200 X 600 Mm Module.Cut Cross Tees Longer Than 600Mm Require Independent Support. 600 X 600Mm Module To Be Formed By Fitting 600Mm Long Flush Fitting Cross Tees Centrally Between The 1200 Mm Cross Tees.Perimeter Trim To Be Wall Angles Of Size 3000X19x19mm, Secured To Walls Using Screws At 450Mm Centre To Centre Maximum. Installation Shall Be Carried Out As Per Manufacturer Recommended Procedure.Suspension System Accessories Supplied By Manufacturer Consisting Of M6 Anchor Fasteners With Hanger Hole, Pre-Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413 Mpa And A Minimum Loading Strength Of 110 Kgs. ( Optionally, Adjustable Hook Clips Made Of 0.7Mm Thick Grade 1 C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main Runners ) . 1713 Prividing And Fixing Acousticalfalse Ceiling With 0.7 Nrc:Sierra Mineral Fibre Acoustical Suspended Ceiling System With 13Mm Thick Microlook Edge Tiles With15mm Face Exposed Grid. The Tiles Shall Have Smooth Laminated Salt Pepper Visual With Humidity Resistance ( Rh ) Of 95%, Nrc 0.7 ( Average Value Of Absorption Co-Efficient Readings Taken At 250 Hz, 500 Hz, 1000 Hz And 2000 Hz ) As Per Astm C423 Standard, Cac Of 28Db As Per Astm E1414, Light Reflectance=85%As Per Astm E-1477, Thermal Conductivity?=0.037W / Mk, Colourglobal White, Fireperformanceof Classa2-S1, D0according Toen 13501-1With 13Mm Microlook Edge And 8Mm Drop In Module Size Of 600 X 600Mm. The Scrim On The Face Of The Tile Shall Be Cleanable. The Tiles Shall Be Classified As Iso 14644-1 Cleanroom Class 5. It Shall Be Suitable For Green Building Application, With Recycled Content Of 60%. Thetileshallhavecertificationsfromgrihaandgreenprotherebyconfirmingthatitisanenvironmentfriendlyproduct. Suspension: The Tile Shall Be Laid On 15 Mm Wide T - Section Flanges Colour Global White ( Matching To Tile Color ) Having Roll Formed Double Stroke Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm & 600 Mm Cross Tees With A Web Height Of 38Mm ( All Sections ) . The Deflection Loading Of The Systemshall Be 12.5 Kg / M2 ( As Per Standard Installationlayout Mentionedbelow ) Andmain Beam Tested As Per Astm C635 ( Deflection Limit Less Than L / 360 ) With A Deflection Loading Of 15Kg / M. The End Details Of The Cross Tee Shall Be Made Of Pre Hardened Steel And Fixed To The Ends Of The Cross Tee To Provide Double Locking Between?Crosstee To Crosstee?And?Crosstee To Mainbeam?.All Main Beam To Main Beam And Cross Tee To Cross Tee Connection Shall Have A Pull Out Strength Of More Than 100Kg. The T Sections Shall Be Made Of Hot Dipped Galvanized Steel Of 90 Gsm As Per Is 277 ( 2003 ) And Pre-Painted Steel With Baked Polyesterpaintwith0t Bendingcapability.All Bordercrosstee / Mainbeamshall Belevelledusingperimeterfill.Thetile&Grid System Used Together Shall Carry A 10 Year Warranty Against Manufacturing Defect And Manufacturer Shall Provide A Warranty Certificate. Thetile&Gridshall Havethemanufacturersnameembossed / Printedonit.Thesupplyshall Bebackedbyamanufacturingtest Certificate.Installation: Tocomprisemainrunnerspacedat1200mmsecurely Fixedtothe Structural Soffit Usingsuspension System ( Specifications Above ) At 1200Mmmaximum. The First / Last Suspensionsystemat The Endof Eachmainrunnershall Not Be Greater Than 450Mm From The Adjacent Wall Along With The First And The Last Main Beam Shall Be At Less Than 600Mm From The Wall.Flush Fitting 1200Mm Long Cross Tees To Be Interlocked Between Main Runners At 600Mm To Form 1200 X 600 Mm Module.Cut Cross Tees Longer Than 600Mm Require Independent Support. 600 X 600Mm Module To Be Formed By Fitting 600Mm Long Flush Fitting Cross Tees Centrally Between The 1200 Mm Cross Tees.Perimeter Trim To Be Wall Angles Of Size 3000X19x19mm, Secured To Walls Using Screws At 450Mm Centre To Centre Maximum. Installation Shall Be Carried Out As Per Manufacturer Recommended Procedure.Suspension System Accessories Supplied By Manufacturer Consisting Of M6 Anchor Fasteners With Hanger Hole, Pre-Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413 Mpa And A Minimum Loading Strength Of 110 Kgs. ( Optionally, Adjustable Hook Clips Made Of 0.7Mm Thick Grade 1 C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main Runners ) . 1714 Prividing And Fixing Acousticalfalse Ceiling With 0.9 Nrc:Sierra Mineral Fibre Acoustical Suspended Ceiling System With 15Mm Thick Sierra Op Tegular 15 / 90 Edge Tiles Withsuprafine 15Mm Face Exposed Grid. The Tiles Shall Have Smooth Laminated Visual With Humidity Resistance ( Rh ) Of 95%, Nrc 0.90 ( Average Value Of Absorption Co-Efficient Readings Taken At 250 Hz, 500 Hz, 1000 Hz And 2000 Hz ) As Per Astm C423 Standard, Cac Of 25Db As Per Astm E1414, Light Reflectance=86%As Per Astm E-1477, Thermal Conductivity?= 0.040 W / Mk, Colour Global White, Fire Performance Of Class A2-S1, D0 According To En 13501-1 With 15Mm Tegular15 / 90°Edge And 8Mm Drop In Module Size Of 600 X 600Mm. The Scrim On The Face Of The Tile Shall Be Cleanable And Classified As Iso 14644-1 Cleanroom Class 5. It Shall Be Suitable For Green Building Application, With Recycled Content Of 43%Andvocemissions ( French ) Classof A+.Thetileshall Haveenvironmental Productdeclarationasper Iso14025anden 15804+A2. The Tile Shall Have Certifications From Griha And Greenpro Thereby Confirming That It Is An Environment Friendly Product. Suspension: The Tile Shall Be Laid Onsuprafine 38 With 15 Mm Wide T - Section Flanges Colour Global White ( Matching To Tile Color ) Having Roll Formed Double Stroke Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm & 600 Mm Cross Tees With A Web Height Of 38Mm ( All Sections ) . The Deflection Loading Of The System Shall Be 12.5 Kg / M2 ( As Per Standard Installation Layout Mentioned Below ) Andmainbeamtestedas Per Astm C635 ( Deflectionlimit Less Thanl / 360 ) Witha Deflectionloading Of 15Kg / M.Theend Details Of The Cross Tee Shall Be Made Of Pre Hardened Steel And Fixed To The Ends Of The Cross Tee To Provide Double Locking Between?Crosstee To Crosstee?And?Crosstee To Mainbeam?.All Main Beam To Main Beam And Cross Tee To Cross Tee Connection Shall Have Apull Out Strength Of More Than 100Kg. The T Sections Shall Be Made Of Hot Dipped Galvanized Steel Of 90 Gsm As Per Is 277 ( 2003 ) And Pre-Paintedsteelwithbakedpolyesterpaintwith0tbendingcapability.Allbordercrosstee / Mainbeamshallbelevelledusing Perimeter Fill. The Tile & Grid System Used Together Shall Carry A 10 Year Warranty Against Manufacturing Defect And Manufacturer Shall Provide A Warranty Certificate. The Tile & Grid Shall Have The Manufacturers Name Embossed / Printed On It. The Supply Shall Be Backed By A Manufacturing Test Certificate. Installation: To Comprise Main Runner Spaced At 1200Mm Securely Fixed To The Structural Soffit Usingsuspension System ( Specifications Above ) At 1200Mm Maximum. The First / Lastsuspension System At The End Of Each Main Runner Shall Not Be Greater Than 450Mm From The Adjacent Wall Along With The First And The Last Main Beam Shall Be At Less Than 600Mm Fromthewall.Flushfitting1200mmlongcrossteestobeinterlockedbetweenmainrunnersat600mmtoform1200x600mm Module.Cut Cross Tees Longer Than 600Mm Require Independent Support. 600 X 600Mm Module To Be Formed By Fitting 600Mm Long Flush Fitting Cross Tees Centrally Between The 1200 Mm Cross Tees.Perimetertrimtobe Wallanglesofsize3000x19x19mm, Securedtowallsusingscrewsat450mmcentretocentremaximum. Installation Shall Be Carried Out As Perrecommended Procedure.Suspension System Accessories Supplied Byconsisting Of M6 Anchor Fasteners With Hanger Hole, Pre-Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413 Mpa And A Minimum Loading Strength Of 110 Kgs. ( Optionally, Adjustable Hook Clips Made Of 0.7Mm Thick Grade 1 C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main 1715 Natural Bamboo Wall Panelling : Providing & Fixing Of Wooden Grill Panel With Backer Made Of Natural Bamboo With 24Mm Face Black Exposed Grid. The Grill Panels Shall Be Made Of Rapidly Renewable Natural Bamboo Core Having Density 600+Kgs / M3 As Per Bs En323 ( 1993 ) And Bending Strength Of 96+ N / Mm2 As Per Bs En310 ( 1993 ) . The Grill Panel Shall Have A Seven Layer Uv Coating Of Thickness 0.09-0.11Mm As Per Bs En71 Finished To Natural Or Carbonized Shades. The Grill Panel Shall Be Of Nominal Size 35X300x2400mm Comprising 8 Blades / Slats Of 35X16x2376mm With Centre To Centre Spacing Of 37.5Mm Fixed Through Backer Of Size 12X22x300mm Having Centre To Centre Spacing Of 300Mm And Additional End Backers At 150Mm From Both The Edges. The Grill Panel Shall Have A Fire Performance Of Class A According To Astm-E84. The Grill Panel Shall Have Moisture Content Of 8-14% As Per Is 1708 ( Part 1 ) :1986 And A Humidity Resistance ( Rh ) Of 70%. 1716 Natural Bambooceiling: Providing & Fixing Of Wooden Grill Panel With Backer Made Of Natural Bamboo With 24Mm Face Black Exposed Grid. The Grill Panels Shall Be Made Of Rapidly Renewable Natural Bamboo Core Having Density 600+Kgs / M3 As Per Bs En323 ( 1993 ) And Bending Strength Of 96+ N / Mm2 As Per Bs En310 ( 1993 ) . The Grill Panel Shall Have A Seven Layer Uv Coating Of Thickness0.09-0.11Mmasperbsen71finishedtonaturalorcarbonizedshades.Thegrillpanelshallbeofnominalsize 35X300x2400mm Comprising 8 Blades / Slats Of 35X16x2376mm With Centre To Centre Spacing Of 37.5Mm Fixed Through Backer Of Size 12X22x300mm Having Centre To Centre Spacing Of 300Mm And Additional End Backers At 150Mm From Both The Edges. The Grill Panel Shall Have A Fire Performance Of Class A According To Astm-E84. The Grill Panel Shall Have Moisture Content Of 8-14% As Per Is 1708 ( Part 1 ) :1986 And A Humidity Resistance ( Rh ) Of 70%. Suspension: The Tile Shall Be Installed On 24 Mm Wide T - Section Flanges Having Rotary Stitching On All T Sections I.E. The Main Runner, 1200 Mm & 600 Mm Cross Tees With A Web Height Of 43Mm, 35Mm And 30Mm Respectively. The Deflection Loading Of The System Shall Be 17.8 Kg / M2 ( As Per Standard Installation Layout Mentioned Below ) And Main Beam Tested As Per Astm C635 ( Deflection Limit Less Than L / 360 ) With A Deflection Loading Of 21.4Kg / M. The End Details Of The Main Beam And Cross Tee Shall Be Made Of Pre Hardened Steel Fixed To The Ends. The Cross Tee To Provide Double Locking Between?Cross Tee To Crosstee?And?Crosstee To Mainbeam?.All Main Beam To Main Beam And Cross Tee To Cross Tee Connection Shall Have A Pull Out Strength Of More Than 100Kg. The T Sections Shall Be Made Of Hot Dipped Galvanized Steel Of 100 Gsm As Per Is 277 ( 2003 ) And Pre- Painted Steel With Baked Polyester Paint With 0T Bending Capability. All Exposed Panel Ends To Be Covered Using Edge Caps. All Wall Angles To Be Covered Using Ledgers. Installation Should Be Carried Out As Per Manufacturer Recommended Procedure. The Grid Shall Be Installed With Suspension System Of Recommended Make. Installation:Tocomprisemainrunnerspacedat1200mmcentretocentresecurelyfixedtothestructuralsoffitusingsuspensionsystem ( Specifications Below ) At 1200Mm Maximum Centre.The First / Last Suspension System At The End Of Each Main Runner Should Not Be Greater Than 450Mm From The Adjacent Wall.Flush Fitting 1200Mm Long Cross Tees To Be Interlocked Between Main Runners At 600Mm Centre To Form 1200 X 600 Mm Module.Cut Cross Tees Longer Than 600Mm Require Independent Support.600 X 600Mm Module To Be Formed By Fitting 600Mm Long Flush Fitting Cross Tees Centrally Between The 1200 Mm Cross Tees.Perimeter Trim To Be Wall Angles Of Size 3000X19x19mm, Secured To Walls At 450 Mm Maximum Centre To Centre.Metal Spring Backer Clips Shall Be Used To Fix The Grill Panel To Suspension System With A Grid Formation Of 600Mm Along The Blade / Slat And 2 Pieces Along Each Backer ( Total 8 Clips Per Full Panel Size ) For Every Individual Panel. Raise The Panel Up Against The Suspension System And Align The Backers With The Suspension System. Push Upwards On The Spring Backer Clip To Engage The Clip Tabs On To The Suspension System Flange. Ensure That Both Clip Tabs Engage The Suspension System Flange.Suspensionsystemaccessoriesmanufacturedandsuppliedby Manufacturerconsistingof M6anchorfastenerswithhanger Hole, Pre Straightened Hanger Wire Of Dia–2.5 Mm Of 1.80 M Length Having A Tensile Strength Of 344-413 Mpa And A Minimum Loading Strength Of 110 Kgs. Additionally, Adjustable Hook Clips Made Of 0.7Mm Thick Grade 1 C55 Galvanized Spring Steel Of Dimension 100 X 20Mm And 4 Mm Aquiline Wire To Be Used For Level Adjustment During Installation Purpose In Main Runners. 1717 Providing And Fixinginterior Wall To Wall Expansion Joint Cover Model W90 For 50 Mm Gap Size, This Surface Mounted Aluminium Cover Is Designed For Interior Application Where Low Maintenance Is Desirable. This Model Is Made Using Aluminium Alloy 6063 And Temper T5 / T6. This Cover Is Installed Using Stailness Steel Clip In The Rear Which Helps The Movement To + 10 Mm. 1718 Providingandfixingof External Walltowallcovermodelasm200xfor50mmgapsize, Thissurface- Mountedmetalwallcoverisdesignedforexteriorapplicationswhere Lowmaintenance Ortamper-Resistant Applications Are Desired. The Free-Floating Aluminum Center Plate Spans The Joint And Slides Over The Surface Of Thewalltoallowrequiredmovement.Epdmvaporbarriertoprotectthejointwithwater.Thisprofileis Extrudedaluminumwithastmb221, Alloy6063-T5.Thisprofilehasbeentestedunderarchitectural Testing Agency ( An Intertek Company ) For The Movement Performance. The Minimum Opening Of The Profile Is 10Mm ( -40Mm ) And The Maximum Openeing Of The Profile Is 76Mm ( +26Mm ) Which Is More Than ±50% Movement. 1719 Providing And Fixig Offloor To Floor Expansion Joint Cover Gft 200 For 50 Mm Gap Size. The Cover Which Is Designedforinteriorfloortofloorapplicationsuitableformostfloorfinisheswhereframedepthand Configuration Is Variable To Suit Selected Finish. It Is A Gasketed Floor To Floor Joint Cover Comprises Of Extruded Aluminium Frames Made Of Aluminium Alloy 6063 Temper T5 / T6 And Tpr Seal Having Strength Of 90 Shore A As Per Astm D2000 And Available In 4 Colours, With Standard Loading Capacity Of 500 Lbs. The Nominal Joint Widthoftheprofileis51mmwhichcontractsdownto38mmasminimumandcanexpand64mmas Maximum, Themovementhasbeentestedwitharchitecturaltestinginc., Anintertekcompany ( Intertek– Ati ) As Per Astm E 1399-97 Report No. 84287.01-106-31 1720 Providing Andfixingof Externalroofcovermodelrjt200for50mm Gapsize, Aluminium Roofcover Comprised Of Extruded Alumunium Components, Injection Molded Turnbar, Duroflex Gaskets And Epdm Vapor Barrier.This Profile Is Extrudedaluminum Withastmb221, Alloy 6063-T5.This Profile Has Beentested Under Architectural Testing Agency ( Anintertek Company ) For The Movement Performance. The Minimum Opening Of The Profile Is 3Mm ( -47Mm ) And The Maximum Openeing Of The Profile Is 92Mm ( +42Mm ) Which Is More Than ±50% Movement. 1721 Supplying And Providing Various Materials For Reed Bed Filter Media Of 1 Meter Depth Comprising Of 300 Mmthickbrickbatsatbottom, 60Mm / 40Mm Gravel150mmthickoverit, 20Mmgravel100mm Thick, Naturalsand100mmthick, Activatedcharcoal60 / 40Mm50kg175mmthick, 50Kgofcocopitin Powder Form 175 Mm Thick And 5 Nos Aquatic Plants At Top.The Rate Is Exclusive Of Cost Of Tank Butinclusiveof Fixing Non Return Valve Including All Materials Labour Etc. 1722 Providing And Fixing In Position Factory Made Eps Cement Sandwich Wall / Roof / Floor Light Weight Solidcore Pannel Made Of Core Material Of Eps Granule Ball / Beads ( Conforming To Is 4671:1984 And Shall Have Density Notlessthan15kgpercum ) Adhesive, Cement, Sand, Flyashandotherbonding Materialinmortarstate Processedto Form Ina Preset Mould. The Outer Face Onbothsides Of The Panelswill Be Nonasbestosfibre Cement Board Confirming To Is 14862:2000 Or Calcium Silicate Board Confirming To En 14306:2009 Of 5 Mm Thick Each Panels Shall Be Laid On 6 Mm Thick Cement Mortar ( 1 Cement : 2 Fine Sand ) Mixed With Chemical Adhesive Of 0.5 Kgper 50 Kg Of Cement Or Shall Be Preferbly Fixed Into CChannel Made Of 1.2 Mm Thick Ms Plate Screwed / Fastenered To The Salb / Coloumn / Beam Etc. The Panel Shall Fixed Vertically With Tongue And Groovejointandhorizontallylockedwithsteelbarbetweeneachotherandfloorsandfilledwithcement Mortar Andadhesive. Panels Shouldbe Usedasfloor Androofing Withadditional Structure Support, Steelor Rccdependinguponthedesign.Alltheoperationshallbecompletedinallrespectasperdrawing, Manufacturing Specification And Under The Overall Direction Of Enginner-In-Charge ( Cost Oa All The Material Is Included Except C Channel Which Will Be Paid Separtely ) A ) Non Load Bearing Panels 60 Mm Thick Required Size 1723 Providing And Fixing In Position Factory Made Eps Cement Sandwich Wall / Roof / Floor Light Weight Solidcore Pannel Made Of Core Material Of Eps Granule Ball / Beads ( Conforming To Is 4671:1984 And Shall Have Density Notlessthan15kgpercum ) Adhesive, Cement, Sand, Flyashandotherbonding Materialinmortarstate Processedto Form Ina Preset Mould. The Outer Face Onbothsides Of The Panelswill Be Nonasbestosfibre Cement Board Confirming To Is 14862:2000 Or Calcium Silicate Board Confirming To En 14306:2009 Of 5 Mm Thick Each Panels Shall Be Laid On 6 Mm Thick Cement Mortar ( 1 Cement : 2 Fine Sand ) Mixed With Chemical Adhesive Of 0.5 Kgper 50 Kg Of Cement Or Shall Be Preferbly Fixed Into CChannel Made Of 1.2 Mm Thick Ms Plate Screwed / Fastenered To The Salb / Coloumn / Beam Etc. The Panel Shall Fixed Vertically With Tongue And Groovejointandhorizontallylockedwithsteelbarbetweeneachotherandfloorsandfilledwithcement Mortar Andadhesive. Panels Shouldbe Usedasfloor Androofing Withadditional Structure Support, Steelor Rccdependinguponthedesign.Alltheoperationshallbecompletedinallrespectasperdrawing, Manufacturing Specification And Under The Overall Direction Of Enginner-In-Charge ( Cost Oa All The Material Is Included Except C Channel Which Will Be Paid Separtely ) B ) Non Load Bearing Panels 75 Mm Thick Required Size 1724 Providing And Fixing In Position Factory Made Eps Cement Sandwich Wall / Roof / Floor Light Weight Solidcore Pannel Made Of Core Material Of Eps Granule Ball / Beads ( Conforming To Is 4671:1984 And Shall Have Density Notlessthan15kgpercum ) Adhesive, Cement, Sand, Flyashandotherbonding Materialinmortarstate Processedto Form Ina Preset Mould. The Outer Face Onbothsides Of The Panelswill Be Nonasbestosfibre Cement Board Confirming To Is 14862:2000 Or Calcium Silicate Board Confirming To En 14306:2009 Of 5 Mm Thick Each Panels Shall Be Laid On 6 Mm Thick Cement Mortar ( 1 Cement : 2 Fine Sand ) Mixed With Chemical Adhesive Of 0.5 Kgper 50 Kg Of Cement Or Shall Be Preferbly Fixed Into CChannel Made Of 1.2 Mm Thick Ms Plate Screwed / Fastenered To The Salb / Coloumn / Beam Etc. The Panel Shall Fixed Vertically With Tongue And Groovejointandhorizontallylockedwithsteelbarbetweeneachotherandfloorsandfilledwithcement Mortar Andadhesive. Panels Shouldbe Usedasfloor Androofing Withadditional Structure Support, Steelor Rccdependinguponthedesign.Alltheoperationshallbecompletedinallrespectasperdrawing, Manufacturingspecificationandundertheoveralldirectionofenginner-In-Charge ( Costoaallthe Material Is Included Except C Channel Which Will Be Paid Separtely ) C ) Non Load Bearing Panels 90 Mm Thick Required Size 1725 Providing And Fixing In Position Factory Made Eps Cement Sandwich Wall / Roof / Floor Light Weight Solidcore Pannel Made Of Core Material Of Eps Granule Ball / Beads ( Conforming To Is 4671:1984 And Shall Have Density Notlessthan15kgpercum ) Adhesive, Cement, Sand, Flyashandotherbonding Materialinmortarstate Processedto Form Ina Preset Mould. The Outer Face Onbothsides Of The Panelswill Be Nonasbestosfibre Cement Board Confirming To Is 14862:2000 Or Calcium Silicate Board Confirming To En 14306:2009 Of 5 Mm Thick Each Panels Shall Be Laid On 6 Mm Thick Cement Mortar ( 1 Cement : 2 Fine Sand ) Mixed With Chemical Adhesive Of 0.5 Kgper 50 Kg Of Cement Or Shall Be Preferbly Fixed Into CChannel Made Of 1.2 Mm Thick Ms Plate Screwed / Fastenered To The Salb / Coloumn / Beam Etc. The Panel Shall Fixed Vertically With Tongue And Groovejointandhorizontallylockedwithsteelbarbetweeneachotherandfloorsandfilledwithcement Mortar Andadhesive. Panels Shouldbe Usedasfloor Androofing Withadditional Structure Support, Steelor Rccdependinguponthedesign.Alltheoperationshallbecompletedinallrespectasperdrawing, Manufacturing Specification And Under The Overall Direction Of Enginner-In-Charge ( Cost Oa All The Material Is Included Except C Channel Which Will Be Paid Separtely ) D ) Non Load Bearing Panels 100 Mm Thick Required Size 1726 Providing And Laying Of White Pre-Formed Patterned Pavement Marking Tapes, With Pre-Coated Self-Adhesive, Having Abrasion-Resistant High Refractive Index Microcrystalline Ceramic Beads Bonded To A Highly Durable Top Coat, Having A Nominal Thickness Of 2.0 Mm At Pattern Heights, Meeting The Requirements Specified In Astm D4505-12.Thepatternedsurfaceshallhaveapproximately50%±15%Ofthesurfacearearaisedand Presenting A Near Vertical Face, Angled From 0 Degree To 60 Degree, To Traffic From Any Direction.All Microcrystalline Ceramic Beads Shall Have A Minimum Index Of Refraction Of 2.3 And 1.8 And Ceramic Beads Shall Show Resistance To Corrosion On Exposure To A 1% Solution Of Sulfuric Acid.The Applied Marking Surface To Be Level, Uniform And Free From Streaks, Cracks And Holes. Markings Shall Have Initial Average Skid Resistance Value Of At Least 45 Bpn When Tested According To Astm E303 And Meet The Initialretroreflectanceaverage Valuesasmeasuredinaccordancewiththestatedtestingproceduresinthe Following Table:Test Method ( Description Of Conditions ) Typical Average Initial Coefficients Of Retroreflected Luminance, Rl Astm E1710 ( Dry Average ) 500 Mcd / M2 / Luxastm E2177 ( Wet Recovery Average ) 250 Mcd / M2 / Lux Astm E2832 ( Wet Continuous Average ) 250 Mcd / M2 / Lux*Observation Angle = 1.05°, Entrance Angle = 88.8° 1727 Providingandlayingofwhite Contrastpre-Formedpatternedpavementmarkingtapes, Withpre-Coatedself- Adhesive, Having Abrasion-Resistant Highrefractive Indexmicrocrystalline Ceramic Beads Bondedto A Highly Durable Top Coat, Having A Nominal Thickness Of 2.0 Mm At Pattern Heights, Meeting The Requirements Specified In Astm D4505-12. The Patterned Surface Shall Have Approximately 50% ± 15% Of The Surface Area Raised And Presenting A Near Vertical Face, Angled From 0 Degree To 60 Degree, To Traffic From Any Direction.Contrast Markings Shall Consist Of Durable, Retroreflective White, Pliant Polymer Materials With Durable Matte Black, Non-Reflective, Pliant Polymer Borders.All Microcrystalline Ceramic Beads Shall Have A Minimum Index Of Refraction Of 2.3 And 1.8 And Ceramic Beads Shall Show Resistance To Corrosion On Exposure To A 1% Solution Of Sulfuric Acid.The Applied Marking Surface To Be Level, Uniform And Free From Streaks, Cracks And Holes. Markings Shall Have Initial Average Skid Resistance Value Of At Least 45 Bpn When Tested According To Astm E303 And Meet The Initialretroreflectanceaverage Valuesasmeasuredinaccordancewiththestatedtestingproceduresinthe Following Table:Test Method ( Description Of Conditions ) Typical Average Initial Coefficients Of Retroreflected Luminance, Rl Astm E1710 ( Dry Average ) 500 Mcd / M2 / Luxastm E2177 ( Wet Recovery Average ) 250 Mcd / M2 / Lux Astm E2832 ( Wet Continuous Average ) 250 Mcd / M2 / Lux*Observation Angle = 1.05°, Entrance Angle = 88.8° 1728 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.A. 600 Mm Diamade Out Of 3Mm Aluminum Composite Materialwith 0.25 Mm Skin Thickness On Either Side 1729 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.B. 750 Mm Diamade Out Of 4Mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1730 Providing And Fixing Mandatory / Regulatory Sign Boards Incircular Shape Of Mm Diamade Out Of Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.C. 900 Mm Diamade Out Of 4Mm Aluminum Composite Material With 0.5 Mm Skin Thickness On Either Side 1731 Providing Andfixing Mandatory / Regulatorysignboardsincircularshape Of Mm Dia Made Outof Mm Aluminum Sheet Bondedwithwhite Retro Reflective Sheeting Of Class B ( Type Ivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.D.1200 Mm Diamade Out Of 4Mm Aluminum Composite Material With 0.5 Mm Skin Thickness On Either Side 1732 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.A. 600 Mm Diamade Out Of3mm Aluminumcomposite Material With 0.25 Mm Skin Thickness On Either Side 1733 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.600 Mm Diamade Out Of 3Mm Aluminumcomposite Material With 0.25 Mm Skin Thickness On Either Sideb. 750 Mm Diamade Out Of4mm Aluminum Composite Material With 0.5 Mm Skin Thickness On Either Side 1734 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.600 Mm Diamade Out Of 3Mm Aluminumcomposite Material With 0.25 Mm Skin Thickness On Either Sidec. 900 Mm Diamade Out Of4mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1735 Providingandfixingmandatory / Regulatorysignboardsincircularshapeof Mmdia Madeoutof Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.600 Mm Diamade Out Of 3Mm Aluminumcomposite Material With 0.25 Mm Skin Thickness On Either Sided. 1200 Mm Diamade Out Of4mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1736 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mm Made Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.600 Mmmade Out Of 3Mm Aluminum Composite Material With 0.25 Mm Skin Thickness On Either Side 1737 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mm Made Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.750 Mmmade Out Of 4Mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1738 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mm Made Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.900 Mmmade Out Of 4Mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1739 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mm Made Out Of Mmaluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint And Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Includingg.I.Fixturesetc;Fixingtheboardsinm25gradeconcreteblockofsize60cmx60cmx75cmincluding Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have7yearswrittenwarranty Fromthemanufacturerandauthoriseddistributor / Convertorissuedforfield Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Filmandthiswarrantycertificate Inoriginalshouldbesubmittedtotheengineerinchargebythe Contractor / Supplier.1200Mm Madeoutof4mmaluminumcompositematerial With0.5Mmskinthicknessoneither Side+F26 1740 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.600 Mmmade Out Of3mm Aluminum Composite Materialwith 0.25 Mm Skin Thickness On Eitherside 1741 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.750 Mmmade Out Of4mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1742 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.900 Mmmade Out Of4mm Aluminum Composite Material With 0.5 Mm Skin Thickness On Either Side 1743 Providing And Fixing Cautionary / Warning Sign Boards In Equilateral Triangle Size Of Mmmade Out Of Mm Aluminum Sheet Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Classc ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.1200 Mmmade Out Of4mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1744 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensitymicro- Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint Andsupported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M25 Grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have 7 Years Written Warrantyfrom The Manufacturer And Authorised Distributor / Convertor Issued For Field Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Film And This Warranty Certificatein Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.750 Mmmade Out Of 4Mm Aluminum Composite Material With 0.5 Mm Skin Thickness On Either Side 1745 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classb ( Typeivhighintensitymicro- Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive / Heat Activated Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3 Supported With Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Grey Stove Enamel Paint Andsupported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Paintedwithwith Flat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards In M25 Grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportation Etc; Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Shall Have 7 Years Written Warrantyfrom The Manufacturer And Authorised Distributor / Convertor Issued For Field Performance Including The Screen Printed Areas And Cut-Out Sheeting And Cut-Out Durable Transparent Overlay Film And This Warranty Certificatein Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.900 Mmmade Out Of 4Mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1746 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classc ( Typeximicroprismaticgrade Sheeting ) Having Pressure Sensitive / Heat Activatedadhesive Retoreflective Specifiedbackground, Borderand Backside Retoreflctive Symbols, Letters, Numerals, Arrowasper Irc:67-2012Table No8.3Supportedwith Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.750 Mmmade Out Of4mm Aluminum Composite Materialwith 0.5 Mm Skin Thickness On Either Side 1747 Providing And Fixing Cautionary / Warning Sign Boards In Octagone Size Of Mmmade Out Of Mm Aluminumsheetbondedwithwhiteretroreflectivesheetingof Classc ( Typeximicroprismaticgrade Sheeting ) Having Pressure Sensitive / Heat Activatedadhesive Retoreflective Specifiedbackground, Borderand Backside Retoreflctive Symbols, Letters, Numerals, Arrowasper Irc:67-2012Table No8.3Supportedwith Backsupportframe25mmx25mmx3mm, Dulypaintedonbacksidewithgreystoveenamelpaintand Supported On One No. Ofm. S. Angle Iron Post Of Size65 Mm X 65 Mm X 6 Mm, 3.45 M Long, Duly Painted Withwithflat Oil Paint Having Alternate Black And White Bands Of 25 Cm Width Including G.I. Fixtures Etc; Fixing The Boards Inm25grade Concrete Block Of Size 60Cm X 60Cm X 75Cm Including Transportationetc; Complete. Class C ( Type Xi Micro Prismatic Grade Sheeting ) Shall Have 10 Years Written Warrantyfrom The Manufacturer Andauthoriseddistributor / Convertor Issuedfor Fieldperformance Including The Screenprinted Areasandcut-Outsheetingandcut-Outdurabletransparentoverlayfilmandthiswarrantycertificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier.900 Mmmade Out Of4mm Aluminum Composite Material With 0.5 Mm Skin Thickness On Either Side 1748 Providingandfixingofretro-Reflectorisedinformatorysignboardrectangular / Squareinshape Having Area Less Than 0.9 Square Meter Made Out Of 4 Mm Aluminum Composite Panel With 0.5 Mm Skin Thickness On Either Side Bonded With White Retro Reflective Sheeting Ofclass B ( Type Iv High Intensity Micro-Prismaticgradesheeting-Hip ) Havingpressuresensitiveadhesiveretoreflectivespecifiedback Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3, Supportedwith Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On One No. Mild Steel Angle Iron Post 75 Mm X 75 Mm X 6 Mm, 3.5 Mt ~ 3.9 Mtlong Firmly Fixed To The Ground By Means Of Properly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paints Having Alternate Black And White Bands Of 25 Cm Width Including Fixures And Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electricallywelded.Classb ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Sheeting Shall Have 7 Yearswritten Warrantyfrom The Manufacturer Including Thedigitally Printedareas With Latex Printing Technology With Sheeting Manufacturer Approved Inks And Laminated With Uv Overlay Film And This Warranty Certificate Along With Sheeting Manufacturer Attested 3 Years Outdoor Weathering Test Report From Indian Govt Lab Must Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1749 Providingandfixingofretro-Reflectorisedinformatorysignboardrectangular / Squareinshape Having Area Less Than 0.9 Square Meter Made Out Of 4 Mm Aluminum Composite Panel With 0.5 Mm Skin Thickness On Either Side Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive Adhesive Retoreflective Specified Back Ground, Border Andbacksideretoreflctivesymbols, Letters, Numerals, Arrowasperirc:67-2012Tableno8.3, Supportedwith Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On One No. Mild Steel Angle Iron Post 75 Mm X 75 Mm X 6 Mm, 3.5 Mt ~ 3.9 Mtlong Firmly Fixed To The Ground By Means Of Properly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paints Having Alternate Black And White Bands Of 25 Cm Width Including Fixures And Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Class C ( Type Xi Micro Prismatic Grade Sheeting ) ) Sheeting Shall Have 10 Yearswritten Warrantyfrom Themanufacturerincludingthedigitallyprintedareaswithlatexprintingtechnology Withsheeting Manufacturer Approved Inks And Laminated With Uv Overlay Film And This Warranty Certificate Along With Sheetingmanufacturerattested3yearsoutdoorweatheringtestreportfromindiangovtlabmustbe Submitted To The Engineer In Charge By The Contractor / Supplier. 1750 Providingandfixingofretro-Reflectorised Informatorysignboardrectangular / Squareinshape Having Area Greater Than 0.9 Square Meter Made Out Of4 Mm Aluminum Composite Panelwith 0.5 Mm Skin Thicknesson Either Sidebondedwithwhiteretroreflectivesheetingofclassb ( Typeivhigh Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive Adhesive Retoreflective Specified Background, Border Andbacksideretoreflctivesymbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3, Supportedwith Back Support Frame 25Mm X 25Mm X 3Mm, Duly Paintedon Backside With Two Coats Of Grey Stove Enamel Paint And Supported On Two No. Mild Steel Angle Iron Post 75 Mm X 75 Mm X 6 Mm, 3.5 Mt ~ 3.9 Mtlong Firmly Fixed To The Ground By Means Of Properly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paints Having Alternate Black And White Bands Of 25 Cm Width Including Fixures And Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electricallywelded.Classb ( Typeivhighintensitymicro-Prismaticgradesheeting-Hip ) Sheeting Shall Have 7 Yearswritten Warrantyfrom The Manufacturerincluding Thedigitally Printedareas With Latex Printing Technology With Sheeting Manufacturer Approved Inks And Laminated With Uv Overlay Film And This Warranty Certificate Along With Sheeting Manufacturer Attested 3 Years Outdoor Weathering Test Report From Indian Govt Lab Must Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1751 Providingandfixingofretro-Reflectorised Informatorysignboardrectangular / Squareinshape Having Area Greater Than 0.9 Square Meter Made Out Of 4 Mm Aluminum Composite Panel Bonded With 0.5 Mm Skinthicknesson Either Sidewith Whiteretro Reflectivesheetingofclassc ( Typexi Typexi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012 Table No 8.3, Supportedwith Back Support Frame 25Mm X 25Mm X 3Mm, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Supported On Two No. Mild Steel Angle Iron Post 75 Mm X 75 Mm X 6 Mm, 3.5 Mt ~ 3.9 Mtlong Firmly Fixed To The Ground By Means Of Properly Designed Foundation With M25 Grade Cement Concrete 45 Cm X 45 Cm X 60 Cm, 60 Cm Below Ground Level As Per Approved Drawing The Angle Iron Postshall Be Duly Painted With One Coat Of Epoxy Primer And Two Coats Of Epoxy Finish Paints Having Alternate Black And White Bands Of 25 Cm Width Including Fixures And Transportation Etc.Complete.The Nut Bolts Of Board With Angle Iron Post / Supporting Structure After Fixing At Site Has To Be Electrically Welded. Classc_ ( Typexitypeximicroprismaticgradesheeting ) Sheetingshallhave10years Written Warrantyfrom The Manufacturerincluding Thedigitally Printedareas With Latex Printing Technology Withsheetingmanufacturerapprovedinksandlaminatedwithuvoverlayfilmandthiswarranty Certificate Along With Sheeting Manufacturer Attested 3 Years Outdoor Weathering Test Report From Indian Govt Lab Must Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1752 Providing And Erectingoverhead Signsmade Out Of4 Mm Aluminum Composite Panelwith 0.5 Mm Skin Thickness On Either Sidebonded With White Retro Reflective Sheeting Ofclass B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive Adhesive Retoreflective Specified Back Ground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012, With Designed Back Support Frame Of Mild Steel Angle With Vertical And Lateral Clearance Given In Clause 801 And 802, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Installed As Per Clause 802.6 Over A Designed Support System Of Structural Steel Work Trestles And Trusses Of Sections And Type As Per Structural Design Requirements And Approved Plans Including Painting With One Coat Of Epoxy Primerandtwocoatsofepoxyfinishpaint.Thenutboltsofboardwithangleironpost / Supporting Structureafterfixingatsitehastobeelectricallywelded.Classb ( Typeivhighintensitymicro- Prismaticgradesheeting-Hip ) Sheetingshallhave7years Writtenwarranty Fromthemanufacturer Includingthedigitallyprintedareaswithlatexprintingtechnologywithsheetingmanufacturer Approvedinksandlaminatedwithuvoverlayfilmandthiswarrantycertificatealongwithsheeting Manufacturer Attested 3 Years Outdoor Weathering Test Report From Indian Govt Lab Must Be Submitted To The Engineer In Charge By The Contractor / Supplier.This Item Does Not Include The Cost Of Structural Steel Work Required For Support System. 1753 Providing And Erectingoverhead Signsmade Out Of4 Mm Aluminum Composite Panelwith 0.5 Mm Skin Thickness On Either Sidebonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismaticgradesheeting ) Havingpressuresensitiveadhesiveretoreflectivespecifiedbackground, Border And Back Side Retoreflctive Symbols, Letters, Numerals, Arrow As Per Irc:67-2012, With Designed Back Support Frame Of Mild Steel Angle With Vertical And Lateral Clearance Given In Clause 801 And 802, Duly Painted On Back Side With Two Coats Of Grey Stove Enamel Paint And Installed As Per Clause 802.6 Over A Designed Support System Of Structural Steel Work Trestles And Trusses Of Sections And Type As Per Structural Design Requirements And Approved Plans Including Painting With One Coat Of Epoxy Primer And Two Coatsofepoxy Finishpaint.Thenutboltsofboardwithangleironpost / Supportingstructureafter Fixingatsitehastobeelectricallywelded. Class_C_ ( Typexitypeximicroprismaticgrade Sheeting ) Sheeting Shall Have 10 Yearswritten Warrantyfrom The Manufacturer Including Thedigitally Printedareas With Latex Printing Technology With Sheeting Manufacturer Approved Inks And Laminated Withuvoverlay Filmandthiswarranty Certificatealongwithsheetingmanufacturerattested3years Outdoor Weathering Test Report From Indian Govt Lab Must Be Submitted To The Engineer In Charge By The Contractor / Supplier.Thisitemdoesnotincludethecostofstructuralsteelworkrequiredforsupport System. 1754 Providingandfixingboarddisplayinginformation, SuchasNameofwork, Tendercost, Nameof Contractor, Work Completion And Liability Period Etc, Having Rectangular Shape Of1.20M X 0.90M Size Madeupof4mmaluminumcompositepannelsheetwith0.5Mmskinthicknessoneitherside Bonded With White Retro Reflective Sheeting Ofclass B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive Adhesive. Retro Reflective Sheeting With Specified Background, Border And Back Side Reto Reflective Symbols, Letters, Numerals, Arrow As Per Irc: 67-2012 Table No 8.3, Onm.S.Angleofsize35x35x3mmframewithproperlycrossbracedm.S.Anglesofsize 35Mmx35mmx3mm Duly Painted Including Two M.S. Angle Iron Posts Of Size 65 Mm X 65 Mm X 6 Mm, 3.65 M Long Painted With Alternate Black And White Bands Of 25 Cm Width Including All Fixtures Etc.And Fixing The Boards In 1:4:8 Concrete Block Of Size 60 Cm X 60 Cm X 75 Cm Including, Excavation, Refilling, Transportation, And Labour Etc Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting- Hip ) Shall Have 7 Years Written Warranty From The Manufacturer Including Thedigitally Printedareas Withlatexprintingtechnologywithsheetingmanufacturerapprovedinksandlaminatedwithuv Overlay Film And This Warranty Certificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1755 Providingandfixingboarddisplayinginformation, SuchasNameofwork, Tendercost, Nameof Contractor, Work Completion And Liability Period Etc, Having Rectangular Shape Of1.20M X 0.90M Size Madeupof4mmaluminumcompositepannelsheetwith0.5Mmskinthicknessoneitherside Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive Adhesive. Retro Reflective Sheeting With Specified Background, Border And Back Side Reto Reflective Symbols, Letters, Numerals, Arrow As Per Irc: 67-2012 Table No 8.3, On M.S.Angle Of Size 35 X 35 X 3 Mm Frame With Properly Cross Braced M.S. Angles Of Size 35Mmx35mmx3mm Duly Painted Including Two M.S. Angle Iron Posts Of Size 65 Mm X 65 Mm X 6 Mm, 3.65 M Long Painted With Alternate Black And White Bands Of 25 Cm Width Including All Fixtures Etc.And Fixing The Boards In 1:4:8 Concrete Blockofsize60cmx60cmx75cmincluding, Excavation, Refilling, Transportation, Andlabouretc Complete.Class_C_ ( Typeximicro Prismaticgradesheeting ) Shallhave10yearswrittenwarranty Fromthemanufacturerincludingthedigitallyprintedareaswithlatexprintingtechnologywith Sheeting Manufacturer Approved Inks And Laminated With Uv Overlay Film And This Warranty Certificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1756 Providingandfixingboarddisplayinginformation, SuchasNameofwork, Tendercost, Nameof Contractor, Work Completion And Liability Period Etc, Having Rectangular Shape Of1.80M X 1.20M Size Madeupof4mmaluminumcompositepannelsheetwith0.5Mmskinthicknessoneitherside Bonded With White Retro Reflective Sheeting Ofclass B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting-Hip ) Having Pressure Sensitive Adhesive. Retro Reflective Sheeting With Specified Background, Border And Back Side Reto Reflective Symbols, Letters, Numerals, Arrow As Per Irc: 67-2012 Table No 8.3, Onm.S.Angleofsize35x35x3mmframewithproperlycrossbracedm.S.Anglesofsize 35Mmx35mmx3mm Duly Painted Including Two M.S. Angle Iron Posts Of Size 65 Mm X 65 Mm X 6 Mm, 3.65 M Long Painted With Alternate Black And White Bands Of 25 Cm Width Including All Fixtures Etc.And Fixing The Boards In 1:4:8 Concrete Block Of Size 60 Cm X 60 Cm X 75 Cm Including, Excavation, Refilling, Transportation, And Labour Etc Complete. Class B ( Type Iv High Intensity Micro-Prismatic Grade Sheeting- Hip ) Shall Have 7 Years Written Warranty From The Manufacturer Including Thedigitally Printedareas Withlatexprintingtechnologywithsheetingmanufacturerapprovedinksandlaminatedwithuv Overlay Film And This Warranty Certificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1757 Providingandfixingboarddisplayinginformation, SuchasNameofwork, Tendercost, Nameof Contractor, Work Completion And Liability Period Etc, Having Rectangular Shape Of1.80M X 1.20M Size Madeupof4mmaluminumcompositepannelsheetwith0.5Mmskinthicknessoneitherside Bonded With White Retro Reflective Sheeting Ofclass C ( Type Xi Micro Prismatic Grade Sheeting ) Having Pressure Sensitive Adhesive. Retro Reflective Sheeting With Specified Background, Border And Back Side Reto Reflective Symbols, Letters, Numerals, Arrow As Per Irc: 67-2012 Table No 8.3, On M.S.Angle Of Size 35 X 35 X 3 Mm Frame With Properly Cross Braced M.S. Angles Of Size 35Mmx35mmx3mm Duly Painted Including Two M.S. Angle Iron Posts Of Size 65 Mm X 65 Mm X 6 Mm, 3.65 M Long Painted With Alternate Black And White Bands Of 25 Cm Width Including All Fixtures Etc.And Fixing The Boards In 1:4:8 Concrete Blockofsize60cmx60cmx75cmincluding, Excavation, Refilling, Transportation, Andlabouretc Complete.Class_C_ ( Typexi Micro Prismaticgradesheeting ) ) Shallhave10yearswrittenwarranty Fromthemanufacturerincludingthedigitallyprintedareaswithlatexprintingtechnologywith Sheeting Manufacturer Approved Inks And Laminated With Uv Overlay Film And This Warranty Certificate In Original Should Be Submitted To The Engineer In Charge By The Contractor / Supplier. 1758 Blasting Powder 1759 Detonator 1760 Fuse 1761 Nipple For Fastening Detenator 1762 Noble Dynamite 1763 Red Tape Safety Fuse 1764 Blasting Fuse ( Fuse Wire ) 1765 M.S.Screws Etc. 35Mm Dia. And 75Mm Long ( 100Nos. ) 1766 Nut Bolts 16Mm Dia. / Nails All Size 1767 Nut Bolts Washers 12Mm Dia. 45Mm Long 1768 Nut Bolts Washers 12Mm Dia. 75Mm Long 1769 M.S. Locking Arrangement For Gate 1770 Binding Wire 1771 Centering Oil 1772 Plastic Cover Block 1773 R.C.C.Jali 50Mm Thick 1774 Plastizer ( Rheobuild ) 825 Rmt. 1775 Concrete Spacer Block 15 Mm 1776 Concrete Spacer Block 20 Mm 1777 Concrete Spacer Block 25 Mm 1778 Concrete Spacer Block 30 / 40 Mm 1779 Anticorrrisive Primer Coat 1780 Swaling Coat 1781 Pvc Coated Gi Wire 1782 Repairs To Cut Ends And Damages With Special Liquid Epoxy 1783 Epoxy Paint 1784 R.C.C.Jali 80Mm Thick 1785 ISt Class Bricks ( Red ) 1786 Aac Block 600X200x100 Mm 1787 Jointing Mortar 1788 Fly Ash Bricks 1789 Corner Stone 38*20*30Cm 1790 Khandakies 1791 Pin Header ( Standard Size ) 1792 Hollow Blocks C.C.0.2*0.2*0.4M 1793 Hollow Blocks C.C.0.1*0.2*0.4M 1794 Hollow Block C C 0.30 X 0.20 X 0.15 1795 Siporex Block 75X240x650 Mm 1796 Gbp Build Fast Plus 1797 Siporex Block 100X240x650 Mm 1798 Siporex Block 200X240x650 Mm 1799 Bitumen ( Compound ) 1800 Brick Bats 1801 Water Proof Compound I.S 1802 Tar Felt B.H.I.S.I.3Mm Thick 1803 Acrylic Polymer Modified Waterproofing Powder 1804 Acrylic Polymer Modified Liquid 1805 Fibre Glass Mesh 1806 Bitumen 85 / 25 Grade 1807 Bitumen 85 / 25 Grade Cold Primer 1808 Grit ( Add Below 5.6 ) 1809 Bitumen Felt 1810 Polydee-Tp40 Primer 1811 Polydee-Tp40 Primer 1812 Polydee-Lm 1813 Polydee-Lm 150Mm Width 1814 Bituflex Cloesdcell Foam 30X30 Mm 1815 Ag 10 Granules 1816 Polydee-Mc 1817 Polydee-41 Sealant And Polyseal 1818 Polydee-11 1819 Bitumen Pad 25Mm Thick 1.20 X 1.20 Mtr 1820 Neeru / Sanala 1821 White Putty ( Cement ) 1822 Texture Material 1823 Rough Shahabad 25 To 30Mm Thick 1824 Rough Shahabad 40 To 45 Mm Thick 1825 Polished Shahabad 25 To 30Mm Thick 1826 Rough Shahabad 50 To 60Mm Thick 1827 Polished Shahabad 40 To 50Mm Thick For Step 1828 Polished Shahabad Machine Cut 25Mm Thick 1829 Polished Shahabad For Step25mm Thick 1830 Tandoor Polished 25Mm Thick ( Machine Cut ) 1831 Tandoor Polished 25Mm Thick ( Hand Cut ) 1832 Tandoor Polished For Steps25mm Thisk 1833 Black Kadappa ( One Side Polish ) ( Machine Cut ) 25 Mm Thick 1834 Black Kadappa ( One Side Polish ) ( Machine Cut ) 35Mm Thick 1835 Both Sides Polished Kadappastone 25Mm Thick 1836 Kota Stone ( Machine Cut ) Upto 25-30Mm Thick One Side Polished 1837 Kota Stone ( Hand Cut ) Upto 25-30Mm Thick One Side Polished 1838 Kota Stone For Step Polished ) Upto 25Mm Thick ( 1.2*0.3M ) 1839 Ceramic Tiles 30*30Cm 1840 Ceramic Antiskid Flooring Tiles 30 X 30 Cm 1841 Ceramic Tiles For Dado 30 Cm X 30 Cm 1842 Ceramic Tiles For Dado 30 X 45 Cm 1843 Heavy Duty Interlocking Concrete Block 60Mm Thick Gray 300 Kg / Sq.Cm. 1844 Heavy Duty Interlocking Concrete Block 60Mm Thick Coloured 300Kg / Sq.Cm 1845 Heavy Duty Interlocking Concrete Block 80Mm Thick Gray 300Kg / Sq.Cm 1846 Heavy Duty Interlocking Concrete Block 80Mm Thick Coloured 300Kg / Sq.Cm 1847 Heavy Duty Interlocking Concrete Block 80Mm Thick Rubber Mould Glossy 400Kg / Sq.Cm 1848 Heavy Duty Interlocking Concrete Block 40Mm Thick Colour 200 Kg / Sq.Cm 1849 Telephone Black Granite 1850 Green Marble 1851 Vitrified Tiles Glossy Size 590 To 605 Mm* 590 To 605 Mm*8 To 10Mm 1852 Vitrifiedmatt Finish - Size 590 To 605 Mm* 590 To 605 Mm *8 To 10Mm 1853 Vitrified Rustic Matt Stone Finish Size 590 To 605Mm *590 To 605Mm*8 To 10Mm 1854 Vertified Stone Effect Finish Size 590 To 605Mm* 590 To 605Mm * 8 To 10Mm 1855 Calcet Powder 1856 Black Oxide Powder 1857 Fevi Matt Chemical 10 Kg Bag 1858 Marble Chips 1859 Heavy Duty Interlocking Concrete Block 60Mm Thick Rubber Mould Glossy 400Kg / Sq.Cm 1860 Tremix Treatment 100 Mm Thick 1861 Marble Mosaic Chequered Tiles ( Gray ) 1862 Colour Cement 1863 Heavy Duty Designer Come. Tile For Flooring 1864 Heavy Duty Designer Come. Tile For Steps 1865 Pvc Flooring 1866 Ceramic Tiles For Dado 30 X 60 Cm 1867 Marble ( Other Than White Makrana ) 1868 Kota Stone ( Hand Cut ) Upto 45-55Mm Thick One Side Polished 1869 Vitrifiedmatt Finish - Size 895 To 900 Mm* 895 To 900 Mm *10 To 12 Mm 1870 Bees Wax 1871 Coal Tar 1872 Common Spirit 1873 French Polish 1874 Varnish 1875 Malemaine Polish 1876 C.C.T.W. Ballies 125 Mm Diameter 1877 Oil Enamel Paint / Flat / Glossy Paint ( Ready Mix ) ( With I.S.I. Mark ) 1878 Synthetic Paint ( Ready Mix ) 1879 Catonic Emulsion Paint 1880 White Oil Paint 100Ml Pack Tin 1881 Red Oxide Paint 1882 Cement Paint 1883 Steel Primer 1884 Primer For Plaster Surface 1885 Putty 1886 Boiled Linseed Oil 1887 Linseed Oil Double Boiled 1888 Terpentine 1889 Wood Primer 1890 Brush For Lettring 1891 Brush For Road Marking 5Cm 1892 Brush For Marking Road 8Cm 1893 Brush For Road Marking 10Cm 1894 Lustre Paint 1895 Textured Synthetic Paint 1896 White Lead Paint 1897 Birla Wall Care Putty 1898 Aluminium Paint 1899 Plastic Emulsion Paint 1900 Acraylic Emulsion Paint 1901 Exterior Primer 1902 Weather Shield Paint 1903 Neel 1904 Oil Bound Distemper 1905 Red Powder / Geru 1906 Saras 1907 Scrapping Sand Paper Size ( 30 * 20Cm ) 1908 Dry Distemper 1909 Chunam / White Lime Powder 1910 Paint Luster Paint 1911 Roller Brush 1912 Royale Luxury Emulsion Paint 1913 Country Teak Wood 1914 Ghana Teak Wood 1915 Teak Wood Planks Above 2.5 M Length 1916 Teak Wood Bidding 1 / 2 * 1 / 2 1917 T.W.Balli 100 Mm Dia 1918 Jungle Wood ( Non Teak ) Normal 1919 Bamboo 25Mm Dia. ( 4.5 To 6M ) 1920 Bamboo 50Mm Dia. 1921 Bamboo Matting 1.2*1.8M 1922 Ply Wood 12Mm Thick 1923 Ply Wood 6Mm Thick 1924 Mica Laminate As Per Isi 0.1 Mm Thick 1925 Face Veneel Board 4 Mm Thick 1926 Particle Board B.W.P.Phinol Bond 12Mm Thick 1927 Particle Board B.W.P.Phinol Bond 19 Mm Thick 1928 Formica 1.5 Mm Thick 1929 Tower Bolt Brass Oxidised 10 Mm Dia Length 150 Mm 1930 Ferical 1931 Ply Wood 18Mm Thick Commercial 1932 Teak Wood Battens 50 * 25Mm 1933 Teak Wood Batten 25 Mm * 12 Mm 1934 Veneer 3.5 To 4 Mm Thick 1935 Alluminium Rod 25Mm Dia 1936 A.C.Corrugated Sheet 6Mm Thick 1937 A.C.Sheet Ridge 1938 A.C.Sheet Plain 4Mm Thick 1939 G.C.I. Sheet ( Corrugated ) 22 Bwg 1940 G.C.I. Sheet ( Corrugated ) 24 Bwg 1941 G.I. Sheet ( Plain ) 22 Bwg 1942 G.I. Sheet ( Plain ) 24 Bwg 1943 G.I.Washers 1944 G.I. J Or L Hooks 6 Mm Dia. 1945 Nails Iron All Size 1946 Mangalore Tiles Class Aa 1947 Mangalore Ridge / Hip Tiles 1948 Mangalore Glass Tiles 1949 Mangalore Pattern Cowl Ventilator 1950 G.I. Pre Coated Trapezoidal 0.50 Mm Thick Roof Metalic Coloured Sheet 1951 G.I. Pre Coated Ridge Sheet 1952 Gypsum Powder 1953 Aluminium Alloy Plate 2Mm Thick 1954 Aluminium Sheeting Fixed With Encapsuled Lens Type Reflective Sheeting Including 2% Towardslettering , Cost Of Angle Iron, Cost Of Drilling Holes , Nuts, Bolts Etc. And Signs As Applicable. 1955 Plaster Of Paris 1956 Decorative Board Of Fibrous Plaster Of Paris 12 To 15 Mm 1957 Acoustic Board 12 Mm Thick 1958 Gypsum Board 12.5 Mm Thick 1959 Upvc 3 Layer Trapezoidal 2.00 Mm Sheet 1960 Light Weight Calcium Silicate Tile Of Size 595 X 595 Mm Of Texture Spin Stone / Cosmos / Plain / Glode Fine Fissured. 1961 Bioguard Board 16 Mm 1962 Ultima Tile 1963 Optra Tile 1964 Proflex Sheet 1 Mm 1965 Sky Light 2 Mm Thick 1966 Hanger Rod 4Mm Thick 1967 Level Adjustment Clip Size 85X30x0.8Mm 1968 Dash Fastener 12.5Mm Dia 50Mm Long 1969 Soffit Cleat 25Mmx35mmx1.60Mm 1970 Wooden Screws With Plastic Rawl Plugs 35Mmx8mm 1971 Light Weight Calcium Silicate Tiles Of Size 595X595mm Of Texture Spintone For Tegular Edgeceiling 1972 Plain Zinc Sheet 1973 Upvc Ridge / Hip Tiles 1974 Hanger Wire ( 2.68 Mm Dia ) 1.82 M Long 1975 Dune Edge Tiles 1976 Fine Fissured Edge Tiles 1977 Turbo Ventilator 24 1978 Tarat 36 Width ( Gunny Cloth ) 1979 Wire Glass 1980 Fire Wood 1981 Precoated Galvanised Steel Plain Sheet 1982 Connecting Clip For Supports 1983 Dry Wall Screws 25 Mm 1984 Jointing Compound 1985 Jointing Tape 1986 Minaral Fibre Board 600 X 600 Mm 1987 Perimeter Channel 80 X 8 Mm 1988 Screws 1 12 1989 Screws 1 / 2 1990 Rawal Plug 1991 Plain Zinc Sheet 0.50 Mm Thick 1992 Aldrop 300*16Mm Chromium Plated 1993 Aldrop Iron Oxidise 300*16Mm 1994 Aldrop Stainless Steel 300*16Mm 1995 Handle 125Mm M.S. Chromium Plated 1996 Handle 150Mm Brass Chromium Plated ( Rounded Shape ) 1997 Handle Alluminium 125 Mm 1998 Iron Hinges Chromium Plated 125Mm 1999 But Hinges Alluminium 125Mm 2000 G.I.Screw 50Mm 2001 G.I.Screw 25Mm 2002 Stainless Steel Hinges - 125Mm 14 Gauge ( Heavy Duty ) 2003 Tower Bolt Aluminium 10Mm Dia.Length 250Mm 2004 Tower Bolt Aluminium 10Mm Dia.Length 200Mm 2005 Tower Bolt M.S. Chromium Plated 10Mm Dia, Length 300Mm 2006 Tower Bolt M.S. Chromium Plated 10Mm Dia, Length 200Mm 2007 Cold Rolled Steel Hollow Section Door Frame 1829*610Mm 2008 Aluminium Stay 25Cm 2009 Aluminium Stay 30Cm 2010 Jali Fly Proof 2011 Jali Chicken Mesh 2012 Jali Welded Mesh 25*25* 13 Guage 2013 Jali Welded Mesh 25*25* 11 Guage 2014 Jali Welded Mesh 50*25 13 Guage 2015 Jali Welded Mesh 50*25 11 Guage 2016 Hold Fast Iron 300*40*5Mm 2017 Sliding Door Bolt Stainless Steel 12Mm Dia. 250Mm Length 2018 Glass Plain 3Mm 2019 Glass Plain 5Mm 2020 Glass Obscured ( Bajara ) 5Mm 2021 G.I. Nut Bolt 2022 Housing Box To Rolling Shutter 2023 Mechanical Gear For Rolling Shutter 2024 Mortice Lock Superior 2025 Solid Core Commercial Shutter 30Mm Thick Phenol Bonded With Face Veneer 3 Mm Thick Bothside 2026 Iron Washer 12Mm To 16Mm 2027 Aluminium Section 2028 Nylon / Pvc Gasket 2029 Alluminium Screw 32 X 6 Mm, 25 X 6 Mm 2030 Concealed Locking Arrangement Of 100 Mm Length For Sliding Window 2031 Alluminium Grill 7.50 Mm Thick 2032 Hydraulic Floor Spring Heavy Duty ( 150 Kg Capacity ) Isi Mark 2033 Iron Oxidized Sliding Door Bolt 200 Mm Length, 12 Mm Dia 2034 Powder And Chemicals For Colour Anodizing Process Of Alluminium Sections 2035 Lock For Sliding Shutter 2036 All Bearing Roller 2037 All Frame Rail Angle 2038 Welding Electrodes 2039 C.R.C. Sheet 2040 Abstrone Butadyne Styrine ( Abs ) Door Shutter Including Transportation 2041 Puff Insulation 35-40 Kg / Cumt. Density 2042 Pvc Door Shutter 34 Mm Thick Factory Made Shutter 2043 Frp Door Shutter 30 Mm Thick Factory Made Shutter 2044 Frp Door Shutter 35 Mm Thick Factory Made Shutter 2045 Bison Pannel 2046 Pvc Factory Made Solid Panel Door Shutter With Stainless Steel Fixutres & Fastening 2047 Pvc Factory Made Flush Door 30 Mm With Stainless Steel Fixutres & Fastening 2048 Sliding Door Bolt Chromium Plated 250Mm 2049 Acrylic Plain Sheet 3 Mm 2050 Aldrop Stainless Steel 300*16Mm 2051 Aldrop Stainless Steel 250*16 Mm 2052 Handle 150Mm Stainless Steel ( Rounded Shape ) 2053 Handle 200Mm Stainless Steel ( Rounded Shape ) 2054 Stainless Steel Hinges - 100Mm 14 Gauge ( Heavy Duty ) 2055 Stainless Steel Hinges - 125Mm 14 Gauge ( Heavy Duty ) 2056 Housing Box To Rolling Shutter 2057 Mechanical Gear For Rolling Shutter 2058 Door Stopperstainless Steel 2059 Tower Bolt Stainless Steel 200 Mm 2060 Tower Bolt Stainless Steel 250 Mm 2061 Sliding Door Bolt Stainless Steel 250 Mm 2062 Handle Stainless Steel 100 Mm 2063 Eye Hole Lens 2064 Rolling Shutter 2065 Ply Wood 2066 Stainless Steel Hooks And Eyes 200 Mm 2067 Steel Window 2068 Powder Coating 2069 Rubber Lining 2070 Ply Wood 9 Mm Thick 2071 Laminated Board Double 12Mm Thick 2072 Alluminium Section Anodized 2073 Handle Iron Oxidised 150 Mm 2074 Hinges Iron Oxidised 100 Mm 2075 T. W. Particle Boardboth Face Laminated 12 Mm 2076 Battens T.W. 70 X 45 Mm 2077 Nuts And Bolts 2078 Plain Frp Sheet 22 B.W.G. 2079 Tw Runner ( 6 X 3 ) 2080 Alluminium Screw 2081 F Patti 2082 Teak Wood Planks Above 2.5M Length 2083 Vision Panel 2084 Solid Core Shutter 35 Mm Thick With Commercial Veneer Facing And Phenol Bonded 2085 Oil Paint 2086 Acrylic Plain Sheet 2 Mm Thick 2087 Aluminium Sheet 24 B.W.G 2088 Alluminium Section With Powder Coating 2089 Concealed Lock 2090 Mosquito Proof Nylone Net 2091 Solid Core Commercial Shutter 30Mm Thick Phenol Bonded With Face Veneer 3 Mm Thick Both Side With Bidding Patty 2092 G.I. Pipe 100Mm Dia. Medium Type 2093 G.I. Pipe 100Mm Dia. Heavy Type 2094 G.I. Pipe 15Mm Dia. Medium Type 2095 G.I. Pipe 15Mm Dia. Heavy Type 2096 G.I. Pipe 20Mm Dia. Medium Type 2097 G.I. Pipe 20Mm Dia.Heavy Type 2098 G.I. Pipe 25Mm Dia. Medium Type 2099 G.I. Pipe 25Mm Dia. Heavy Type 2100 G.I. Pipe 32Mm Dia. Medium Type 2101 G.I. Pipe 32Mm Dia.Heavy Type 2102 G.I. Pipe 40Mm Dia. Medium Type 2103 G.I. Pipe 40Mm Dia. Heavy Type 2104 G.I. Pipe 50Mm Dia. Medium Type 2105 G.I. Pipe 50Mm Dia. Heavy Type 2106 G.I. Pipe 65Mm Dia. Medium Type 2107 G.I. Pipe 65Mm Dia. Heavy Type 2108 G.I. Pipe 80Mm Dia. Medium Type 2109 G.I. Pipe 80Mm Dia. Heavy Type 2110 Pvc Nahani Trap 75 Mm 2111 G.I.Clamps 100Mm To 150Mm 2112 Pvc Nahani Trap 150 Mm 2113 G.I.Clamps 12Mm To 32Mm 2114 G.I.Clamps 40Mm To 80Mm 2115 Anglo Indian W.C. Pan Colour 2116 G.I.Fixtures 2117 P.V.C. Cowl 100 Mm 2118 G.I.Screws 30Mm 2119 G.I.Screws 40Mm 2120 G.I.Union 25Mm Dia. 2121 Gully Trap Cover With Frame 2122 Gun Metal Stop Tap With Crutch Wheel 20Mm 2123 Gun Metal Stop Tap With Crutch Wheel 25Mm 2124 Gun Metal Stop Tap With Crutch Wheel 15Mm 2125 Gun Metal Stop Tap With Crutch Wheel 20Mm 2126 C.I.Bend 75Mm Dia. 2127 C.I.Bend 100Mm Dia. 2128 C.I.Bip Tap 12Mm 2129 C.I.Grating 150Mm Dia. 2130 C.I.Grating 100Mm Dia. 2131 C.I.Grating 75Mm Dia. 2132 C.I.Brackets 2133 C.I.Collers 100Mm Dia. 2134 C.I.Copllers 75Mm Dia. 2135 C.I.Cover 45*30 Cm With Frame 2136 C.I.Cowl / Vent 100Mm Dia. 2137 C.I.Cowl / Vent 150Mm Dia. 2138 C.I.Cowl / Vent 75Mm Dia. 2139 C.I.Hinged Cover With Frame 2140 C.I.Man Hole Cover 50 Kg. 2141 C.I.Man Hole Cover 75 Kg. 2142 C.I.Man Hole Cover 100 Kg. 2143 C.I.Man Hole Cover 175 Kg.Heavy ( 0.9*0.45M ) 2144 C.I.Nahani Trap 100Mm Dia. ( 375Mm Long ) 2145 C.I.Nahani Trap 75 To 80Mm Dia. ( 375Mm Long ) 2146 C.I.100*75*300 Long Arm ( Wt. 6Kg ) Nahani Trap 2147 C.I.Soil Pipe 100Mm Dia. 2148 C.I.Soil Pipe 150Mm Dia. 2149 C.I Soil Pipe 75 To 80Mm Dia. 2150 C.I.Shoe 75 Mm Dia. 2151 C.I. Shoe 100 Mm Dia. 2152 C.I.Shoe 150Mm 2153 Ball Cock 15Mm Dia.P.V.C.Float 2154 Ball Cock 25Mm Dia.P.V.C.Float 2155 Ball Cock 40Mm Dia.P.V.C.Float 2156 Ball Cock 50Mm Dia.P.V.C.Float 2157 Bib Cock Stop Tap Brass Heavy 15Mm 2158 Bib Cock Stop Tap Brass Heavy 20Mm 2159 Bib Cockstop Tap Brass Heavy 25Mm 2160 Bib Tap 12Mm Brass Medium 2161 Colour Wash Hand Basin 55*40Cm 2162 Colour Wash Hand Basin 63*45Cm 2163 White Glazed Wash Basin 45*30Cm 2164 White Glazed Wash Hand Basin 55*50Cm 2165 P.V.C. Flexible Waste Pipe 32 Mm Dia 2166 White Glazed Wash Hand Basin 63 X 45 Cm 2167 Sink White Glazed 45*20*30Cm 2168 Pedestal For Wash Basin ( Standard Size ) 2169 C.C.Septic Tank 0.9M Dia. ( 2.5M Long ) 2170 C.C.Septic Tank 1.20M Dia. ( 2.5M Long ) 2171 C.I.Steps For Manhole 2172 C.I.Cover With Frame ( Gully Trap ) 2173 C.I.Plug Bend 150Mm Dia. 2174 Clamp For G.I.Pipe 25Mm 2175 Colour European Type W.C.Pan 2176 European Type Glazed W.C.Pan 2177 W.C.Pan Coloured Glazed 64Cm. ( Orissa ) 2178 W.C.Pan White Glazed 58 Cm.Indian 2179 W.C.Pan White Glazed 57.50 Cm ( Orissa ) 2180 Fibre Flushing Tank For W.C. 2181 Flushing Tank Automatic Urinal 10Ltr. C.I. 2182 Flushing Tank Automatic Urinal 5Ltr. ( P.V.C. ) 2183 Low Level Flush Pr. St. 10Ltr. 2184 Flat Back Urinal 2185 Stall Type Urinal 2186 Lipped Type Urinal 2187 Coloured Glazed Full Stall Urinal 2188 Bleaching Powder 2189 Potassium Permanganate 2190 Nylon Brush 2191 Duster 2192 Plastic Bucket 2193 Coir 2194 Gunny Cloth 2195 Kharata 2196 Wheel Stop Tap Brass 15Mm 2197 Wheel Stop Tap Brass 20Mm 2198 Wheel Stop Tap Brass 25Mm 2199 Socket Brass For 32Mm Tap 2200 Socket Brass For 40Mm Tap 2201 Socket Brass For 50Mm Tap 2202 Socket Brass For 65Mm Tap 2203 Socket For 100Mm Tap 2204 Socket For 15Mm Tap 2205 Socket For 20Mm Tap 2206 Socket For 25Mm Tap 2207 Socket For 32Mm Tap 2208 Socket For 40Mm Tap 2209 Socket For 50Mm Tap 2210 Socket For 65Mm Tap 2211 Socket For 80Mm Tap 2212 Span Yarn 2213 Strainer For 100Mm 2214 Strainer For 40Mm 2215 Strainer For 50Mm 2216 Strainer For 80Mm 2217 Strainer For 15Mm 2218 Strainer For 20Mm 2219 Strainer For 25Mm 2220 Stone Ware Pipe 100Mm Dia. 2221 Stone Ware Pipe 150Mm Dia. 2222 Stone Ware Pipe 225Mm Dia. 2223 Stone Ware Glazed Pipe Half Round 100Mm Dia. 2224 Stop Tap Brass With Crunch Wheel 15Mm Dia. 2225 Towel Rod With Clamps 16Mm Dia. 2226 Mirror 40*50Cm. With Plastic Frame 2227 Brass T Thimble Socket 32Mm Dia. 2228 Brass Wheel Stop Tap 32Mm Dia. 2229 Brass Wheel Stop Tap 40Mm Dia. 2230 Brass Wheel Stop Tap 50Mm Dia. 2231 Brass Wheel Stop Tap 65Mm Dia. 2232 Brass Wheel Stop Tap 80Mm Dia. 2233 Half Turn Flush Cock 25Mm Dia. 2234 12Mm Flexible Inlet Pipe Connection 2235 Bell Mouth Cover 100Mm Dia. 2236 Box Chamber With Lock 0.6*0.45M 2237 Brass Nozzle Pillar Tap 12Mm 2238 Black Bakelite Seat To European Closer 2239 Concussion Push Button Type Gun Metal Tap 15 To 25Mm Dia. 2240 Coupling Cast Iron 100Mm Dia. 2241 Coupling Cast Iron 80Mm Dia. 2242 Chromium Plated 12Mm Dia.Bib Cock 2243 C.I.Trap Grating 15*10 Cm 2244 C.I.Y Junction 100Mm Dia. 2245 C.I.Y Junction 150Mm Dia. 2246 C.I.Y Junction 75Mm Dia. 2247 Enameled Bend 40Mm Dia. 2248 Ferrul For C.I.Pipr 100Mm 2249 White Glazed Foot Rest Chequred 25*10 Cm 2250 Half Round Earthware Pipe 100Mm ( 60Cm Long ) 2251 Half Round Earthware Pipe 150Mm ( 60Cm Long ) 2252 Jute Rope 2253 Half Round Chaina Ware Pipe 100Mm ( 60Cm Long ) 2254 Lead Pipe 32Mm Dia. 2255 Mohagani Seat With Lid 2256 Mosquito Proof Coupling 2257 Non-Return Valve 15Mm For Water Meter 2258 Non-Return Valve 25Mm For Water Meter 2259 Non-Return Valve 20Mm For Water Meter 2260 Piller Tap 12Mm Dia.Chromium Plated Heavy 2261 P.Trap And Lead Pipe Upto 40Mm Dia. 2262 Rubber Gasket ( 2528 And 20 Cm ) 2263 Rubber Incertion 2264 Rubberised Adhesive 2265 Salt Glazed Stone Ware Gully Trap ( 150*150Mm ) 2266 Self Project Tap Brass Chromium Plated 15Mm 2267 Sewer Trap 2268 Shower Rose Chromium Plated Brass 10Cm 2269 P.V.C. Pipe 15Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2270 P.V.C. Pipe 20Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2271 P.V.C. Pipe 25Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2272 P.V.C. Pipe 32Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2273 P.V.C. Pipe 40Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2274 P.V.C. Pipe 50Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2275 P.V.C. Pipe 60Mm Dia.10Kg / Cm2 Pressure ( Class Iv ) 2276 P.V.C. Pipe 75Mm Dia.4 Kg / Cm2 Pressure ( Class Ii ) 2277 P.V.C. 75 Mm Soil Pipe 6 Kg / Cm2 Pressure 2278 P.V.C. Pipe 90Mm Dia.4 Kg / Cm2 Pressure ( Class Ii ) 2279 P.V.C.Pipe 110Mm Dia.4Kg / Cm2 Pressure ( Class Ii ) 2280 P.V.C. 110 Mm Rain Water Pipe 6Kg / Cm2 Pressure 2281 P.V.C. 110 Mm Soil Pipe 6 Kg / Cm2 Pressure 2282 P.V.C.Pipe 140Mm Dia.4Kg / Cm2 Pressure ( Class Ii ) 2283 P.V.C.Pipe 160Mm Dia.4Kg / Cm2 Pressure ( Class Ii ) 2284 P.V.C.Pipe 160Mm Dia.Soil Pipe 2285 P.V.C.Pipe 160Mm Dia. Rain Water Pipe 2286 P.V.C.Socket 15Mm Dia. 2287 P.V.C.Socket 20Mm Dia. 2288 P.V.C.Socket 25Mm Dia. 2289 P.V.C.Socket 32Mm Dia. 2290 P.V.C.Socket 40Mm Dia. 2291 P.V.C.Socket 50Mm Dia. 2292 P.V.C.Socket 60Mm Dia. 2293 P.V.C.Flushing Tank ( 12 Ltr. Capacity ) 2294 Flush Valve 32Mm Dia. 2295 Ferocret Tank 2296 Stainless Steel Sink Of Size 600*510*200Mmof Nirali Or Equivalent Make 2297 C.P.Pillar Cock Jaquar Make Continental ( Cat.No. Con-011 ) 2298 C.P.Pillar Cock ( Isi ) Jaquar Make Continental 2299 C.P.Pillar Cock Long Neck With Aerator Jaquar Make Continental ( Cat.No. Con- 021 ) 2300 C.P.Bib Cock ( Isi ) Jaquar Make Continental ( Cat.No. Con-037 ) 2301 C.P.Bib Cock Long Thread Jaquar Make Continental ( Cat.No. Con-039 ) 2302 C.P.2-Way Bib Cock Jaquar Make Continental ( Cat.No. Con-041 ) 2303 C.P.Bib Cock With Wall Flange Long Thread Jaquar Make Continental ( Cat.No. Con- 047 ) 2304 C.P.Bib Cock With Nozzle Jaquar Make Continental ( Cat.No. Con-049 ) 2305 C.P.Angular Stop Cockjaquar Make Continental ( Cat.No. Con-053 ) 2306 C.P.Angular Stop Cock Long Thread Jaquar Make Continental ( Cat.No. Con-055 ) 2307 C.P.Angular Stop Cock With Wall Flange Jaquar Make Continental ( Cat.No. Con- 059 ) 2308 C.P.Central Hole Basin Mixer Without Popup Waste System With 450Mm Long Braided Hoses Jaquar Make Continental ( Cat.No. Con-167B ) 2309 C.P.Wall Mixer With Telephone Shower Arragnementonly But Without Teltphone Shower Crutch Jaquar Make Continental ( Cat.No. Con-217 ) 2310 C.P.Wall Mixer Non-Telephonic Shower Arrangement Jaquar Make Continental ( Cat.No. Con-219 ) 2311 C.P.Wall Mixer ( Wall Mounted Model ) With Telephone Shower Arrangement Only And Withtelephone Shower Crutch Jaquar Make Continental ( Cat.No. Con-267 ) 2312 C.P.Wall Mixer With Provision For Overheadshower With 115Mm Long Bend Pipe And Wallflange Jaquar Make Continental ( Cat.No. Con-273Upr ) 2313 C.P.Sink Mixer With Swinging Casted Spout ( Wallmounted ) Jaquar Make Continental ( Cat.No.Con-309 ) 2314 C.P.Sink Mixer Swinging Spout ( Table Mounted Model ) 450Mm Long Braided Hoses Jaquar Make Continental ( Cat.No. Con-309B ) 2315 C.P.Sink Cock With Swinging Casted Spout Jaquar Make Continental ( Cat.No. Con- 347 ) 2316 C.P.Sink Cock With Raised J Shaped Swinging Casted Spout ( Table Mounted ) Jaquar Makecontinental ( Cat.No. Con- 359 ) 2317 C.P.Shower Arm 190Mm Long Light Body With Wallflange Jaquar Make Continental ( Cat. No. Sha - 477 ) 2318 C.P.Flush Cock With Wall Flange 25Mm With Plain Knob Jaquar Make Continental ( Cat.No. Flr6081 ) 2319 C.P.Towel Rail 24 Jaquar Make Continental ( Cat. No. Acn 1111N ) 2320 C.P.Towel Ring Square Jaquar Make Continental ( Cat. No. Acn 1121N ) 2321 C.P.Soap Dish Hooker Jaquar Make Continental ( Cat. No. Akb 35731 ) 2322 C.P.Soap Dish ( Polyurethane ) Jaquar Make Continental ( Cat. No. Aqn 7733 ) 2323 C.P.Toilet Paper Holder Jaquar Make Continental ( Cat. No. Aq 7751 ) 2324 C.P.Toilet Rack 24With Lower Hanger Jaquar Make Continental ( Cat. No. Acn 1181N ) 2325 C.P.Handshower ( Health Faucet ) 1M.Pvc Tube With Wall Hook Jaquar Make ( Cat. No. Ald 563 ) 2326 C.P.Pillar Cock Jaquar Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt 7011 ) 2327 C.P.Bib Cock With Wall Flange Aqua Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt7037 ) 2328 C.P.2-Way Bib Cock With Wall Flange Aqua Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt 7041 ) 2329 C.P.Angular Stop Cock With Wall Flange Aqua Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt 7053 ) 2330 C.P.Central Hole Basin Mixer With Regular Spout Without Popup Waste System With 450Mm Longbraided Hoses Jaquar Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt 7167Bb ) 2331 C.P.Central Hole Basin Mixer With Regular Spout With Popup Waste System With 450Mm Longbraided Hoses Jaquar Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt 7169B ) 2332 C.P.Central Hole Basin Mixer With Small Spout Without Popup Waste System With 450Mm Longbraided Hoses Jaquar Make QueenS Collection ( Quarter Turn Fitting ) ( Cat. No. Qqt 7171B ) 2333 C.P.Wall Mixer ( Wall Mounted Model ) With Telephonic Shower Arrangement Only But Withoutcrutchjaquar Make QueenS Collection ( Quarter Turn Filling ) ( Cat. No. Qqt 7217 ) 2334 C.P.Wall Mixer Non-Telephonic Shower System Jaquar Make QueenS Collection ( Quarter Turn Filling ) ( Cat. No. Qqt 7219 ) 2335 C.P.Wall Mixer ( Wall Mounted Model ) With Telephonic Shower Arrangement Only And With Telephone Shower Crutch Jaquar Make QueenS Collection ( Quarter Turn Filling ) ( Cat. No. Qqt7267 ) 2336 Hydraulic Door Closer 2337 Cpvc Pipe 15Mm Dia. 2338 Cpvc Pipe 20Mm Dia. 2339 Cpvc Pipe 25Mm Dia. 2340 Cpvc Pipe 32Mm Dia. 2341 Cpvc Pipe 40Mm Dia. 2342 Cpvc Pipe 50Mm Dia. 2343 Cpvc Coupling For 15Mm Dia. 2344 Cpvc Coupling For 20Mm Dia. 2345 Cpvc Coupling For 25Mm Dia. 2346 Cpvc Coupling For 32Mm Dia. 2347 Cpvc Coupling For 40Mm Dia. 2348 Cpvc Coupling For 50Mm Dia. 2349 Elbow 90 Degree For 15Mm Dia. 2350 Elbow 90 Degree For 20Mm Dia. 2351 Elbow 90 Degree For 25Mm Dia. 2352 Elbow 90 Degree For 32Mm Dia. 2353 Elbow 90 Degree For 40Mm Dia. 2354 Elbow 90 Degree For 50Mm Dia. 2355 Tee For 15Mm Dia. 2356 Tee For 20Mm Dia. 2357 Tee For 25Mm Dia. 2358 Tee For 32Mm Dia. 2359 Tee For 40Mm Dia. 2360 Tee For 50Mm Dia. 2361 End Cap For 15Mm Dia. 2362 End Cap For 20Mm Dia. 2363 End Cap For 25Mm Dia. 2364 End Cap For 32Mm Dia. 2365 End Cap For 40Mm Dia. 2366 End Cap For 50Mm Dia. 2367 Ball Cock For 15Mm Dia. 2368 Ball Cock For 12Mm Dia. 2369 Ball Cock For 25Mm Dia. 2370 Ball Cock For 32Mm Dia. 2371 Ball Cock For 40Mm Dia. 2372 Araldite Adhesive 2373 Ball Valves For 50Mm Dia. 2374 Male Adapter ( Brass Threads ) For 15Mm Dia. 2375 Male Adapter ( Brass Threads ) For 20Mm Dia. 2376 Male Adapter ( Brass Threads ) For 25Mm Dia. 2377 Male Adapter ( Brass Threads ) For 32Mm Dia. 2378 Male Adapter ( Brass Threads ) For 40Mm Dia. 2379 Male Adapter ( Brass Threads ) For 50Mm Dia. 2380 Male Adapter ( Plastic Threads ) For 15Mm Dia. 2381 Male Adapter ( Plastic Threads ) For 20Mm Dia. 2382 Male Adapter ( Plastic Threads ) For 25Mm Dia. 2383 Male Adapter ( Plastic Threads ) For 32Mm Dia. 2384 Male Adapter ( Plastic Threads ) For 40Mm Dia. 2385 Male Adapter ( Plastic Threads ) For 50Mm Dia. 2386 Female Adapter ( Brass Threads ) For 15Mm Dia. 2387 Female Adapter ( Brass Threads ) For 20Mm Dia. 2388 Female Adapter ( Brass Threads ) For 25Mm Dia. 2389 Female Adapter ( Brass Threads ) For 32Mm Dia. 2390 Female Adapter ( Brass Threads ) For 40Mm Dia. 2391 Female Adapter ( Brass Threads ) For 50Mm Dia. 2392 Female Adapter ( Plastic Threads ) For 15Mm Dia. 2393 Female Adapter ( Plastic Threads ) For 20Mm Dia. 2394 Female Adapter ( Plastic Threads ) For 25Mm Dia. 2395 Union For 15Mm Dia. 2396 Union For 20Mm Dia. 2397 Union For 25Mm Dia. 2398 Union For 32Mm Dia. 2399 Union For 40Mm Dia. 2400 Union For 50Mm Dia. 2401 Cross For 15Mm Dia. 2402 Cross For 20Mm Dia. 2403 Step Over Bend 15Mm Dia. 2404 Step Over Bend 20Mm Dia. 2405 Tee Holder For 15Mm Dia. 2406 Tee Holder For 32Mm Dia. 2407 End Plug Threaded For 15Mm Dia. 2408 R.C.C.Chamber Cover With Frame 90Cm*45Cm Heavy Duty 225Kg 2409 R.C.C.Chamber Cover With Frame 90Cm*45Cm Medium Duty 140Kg 2410 R.C.C.Chamber Cover With Frame 60Cm*45Cm Heavy Duty 160Kg 2411 R.C.C.Chamber Cover With Frame 60Cm*45Cm Medium Duty 100Kg 2412 I.S.I.Ferrul Connection15mm Dia. 2413 I.S.I.Ferrul Connection 20Mm Dia. 2414 I.S.I.Ferrul Connection 25Mm Dia. 2415 I.S.I.Ferrul Connection 32Mm Dia. 2416 I.S.I.Ferrul Connection 40Mm Dia. 2417 I.S.I.Ferrul Connection 50Mm Dia. 2418 Water Meter 15 Mm Diameter 2419 Water Meter 20 Mm Diameter 2420 Water Meter 25 Mm Diameter 2421 Water Meter 40 Mm Diameter 2422 Water Meter 50 Mm Diameter 2423 Water Meter 80 Mm Diameter 2424 Water Meter 100 Mm Diameter 2425 Non Return Valve 40 Mm Diameter 2426 Non Return Valve 50 Mm Diameter 2427 Non Return Valve 80 Mm Diameter 2428 Non Return Valve 100 Mm Diameter 2429 Colour Wash Hand Basin 0.45 X 0.30 2430 White Glaze Earth Sink 0.6 X 0.2 X 0.45 2431 Clamp For G.I.Pipe 200Mm 2432 Earopean Type Glazed W.C.Pan 68Cm 2433 Earopean White Glazed Earthen Ware Closet Pan 2434 P.V.C. Nahni Trap 2435 P.V.C. Connector. 15 Mm Dia 2436 Low Level Flushing Cistern 2437 Upvc Sanitary Pipes All 20 Mm Dia. 2438 Upvc Sanitary Pipes All 75 Mm Dia. 2439 Bib Cock Stop Tap Brass Heavy 15Mm 2440 Stainless Steel Sink Of Size 610 X 460 X 200 Mm Of Nirali Or Equivalent Make 2441 Upvc Sanitary Pipes All 63 Mm Dia. 2442 W.C.Pan Colour Glazed 57.50 Cm ( Orissa ) 2443 Piller Cock Mixer & Angle Cock 2444 Upvc Sanitary Pipes All 25 Mm Dia. 2445 Upvc Sanitary Pipes All 15 Mm Dia. 2446 Cement 2447 Upvc Sanitary Pipes All 40 Mm Dia. 2448 Upvc Sanitary Pipes All 50 Mm Dia. 2449 Stainless Steel Sink Of Size 470 X 420 X 178 Mm Of Nirali Or Equivalent Make 2450 Bib Cock Long Arm 2451 Bottletrap Wash Basin 32 Mm Cromium Plated 2452 Upvc Sanitary Pipes All 32 Mm Dia. 2453 Hamp Rope 2454 Bib Cock Cock Stop Tap Brass Heavy 15 Mm 2455 Colour Wash Hand Basin 45*30Cm 2456 Ultra 250 Mm. Dia. Upvc 90 Degree Junction Chamber Base With U Trap 2457 Ultra 250 Mm.Dia. Upvccover & Frame 2458 Upvc Blanking Plug 110 Mm 2459 Upvc 90 Degree Bend 2460 Ultra Shaft 250X470mm 2461 Water Jet With Accessories 2462 White Glazed Full Stall Urinal 2463 Glass Plain 6Mm Thick 2464 White Glazed Earthenware Squatting Plate ( Ladies Urinal ) 2465 Autoclosing Pillar Cock Of Pressmatic Tap 2466 Pvc Aqua Kraft Type Super Bib Tap 15 Mm 2467 Pvc Aqua Kraft Type Super Two Way Bib Tap 15 Mm 2468 Super Push Button Type Cock / Tap With Flange 15 Mm 2469 Pvc Aqua Kraft Type Super Jet Spray 15 Mm 2470 Pvc Aqua Kraft Type Super Right Angle Stop Tap 2471 Pvc Aqua Kraft Type Super Pillar Tap 15 Mm 2472 Fixing In Cc Bk Clamp, Battan 2473 Wall Mounted European Type Glazed W.C.Pan 2474 Super Wall Sink Type Tap With Flange 15 Mm 2475 Two Way Bib Tap With Flange 2476 Super Jet Spray With Flange 2 In 1 Faucet 1.50 Metre Long 2477 Chloryphyriphos 2478 Solvent 2479 D.D.V.P. 2480 Malathion 2481 Pine Oil 2482 S.S. Pipe 40 Mm Dia 2483 Mild Steel 2484 Barbed Wire 2485 Concentina Coil Wire 2486 M.S.Steel 2487 Rcc Pole 2488 Green Marble 2489 Telephone Black Granite 2490 Karva ( For Roof And Sides 10Kg Bundle ) 2491 Tatti 2492 Bamboo 25Mm Dia. 2493 Lightening Conductor 2494 Salt 2495 Copper Tape Width 25Mm*3Mm Thick 2496 Aluminium Strips 50 Mm X 3 Mm 2497 Cripped Wire3 - 0 , 4 - 0 And 5 - 0 Wide 2498 Welding Electrodes 2499 Welded Mesh 75 X 75 Mm 2500 Welded Mesh 150 X 150 Mm 2501 Tarat 36 Width ( Gunny Cloth ) 2502 Chain Link3 - 0 4 - 0 And 5 - 0 Wide 2503 Bamboo 50Mm Dia. 2504 Hold Fast For Steel Gate 2505 Nut Boldts 12 Mm Dia. / Nails All Size 2506 M.S. Pipe 40 Mm Dia 2507 Welding Rod 2508 Pvc Hand Rail Cover 2509 Antitermite Liquid 2510 Lock For Drawer / Cupboard 2511 Glycel 2512 Hing 2513 Hot Lime 2514 Ladder 2515 Fine Tooth Chisel 2516 Saw 2517 Gloves 2518 R.C.C.Pipe 1200Mm Dia. ( Np3 ) 2.5M Long 2519 R.C.C.Pipe 1100Mm Dia. ( Np3 ) 2.5M Long 2520 R.C.C.Pipe 1000Mm Dia. ( Np3 ) 2.5M Long 2521 R.C.C.Pipe 900Mm Dia. ( Np3 ) 2.5M Long 2522 R.C.C.Pipe 800Mm Dia. ( Np3 ) 2.5M Long 2523 R.C.C.Pipe 700Mm Dia. ( Np3 ) 2.5M Long 2524 R.C.C.Pipe 600Mm Dia. ( Np3 ) 2.5M Long 2525 R.C.C.Pipe 500Mm Dia. ( Np3 ) 2.5M Long 2526 R.C.C.Pipe 450Mm Dia. ( Np3 ) 2.5M Long 2527 R.C.C.Pipe Np2 Class 1000Mm Dia. 2.5M Long 2528 R.C.C.Np2 Pipe Collar 1000 Mm Dia. 2529 R.C.C.Pipe Np2 Class 1200Mm Dia. 2.5M Long 2530 R.C.C.Np2 Pipe Collar 1200 Mm Dia. 2531 R.C.C.Pipe Np2 Class 1800Mm Dia. 2.5M Long 2532 R.C.C.Pipe Np2 Class 900Mm Dia. 2.5M Long 2533 R.C.C.Np2 Pipe Collar 900 Mm Dia. 2534 R.C.C.Pipe Np2 Class 800Mm Dia. 2.5M Long 2535 R.C.C.Np2 Pipe Collar 800 Mm Dia. 2536 R.C.C.Pipe Np2 Class 700Mm Dia. 2.5M Long 2537 R.C.C.Pipe Np2 Class 600Mm Dia. 2.5M Long 2538 R.C.C.Np2 Pipe Collar 600 Mm Dia. 2539 R.C.C.Pipe Np2 Class 500Mm Dia. 2.5M Long 2540 R.C.C.Pipe Np2 Class 450Mm Dia. 2.5M Long 2541 R.C.C.Np2 Pipe Collar 450 Mm Dia. 2542 R.C.C.Pipe Np2 Class 100Mm Dia. 2M Long 2543 R.C.C.Pipe Np2 Class 150Mm Dia. 2M Long 2544 R.C.C.Pipe Np2 Class 225Mm Dia. 2M Long 2545 R.C.C.Pipe Np2 Class 300Mm Dia. 2M Long 2546 Rcc Pipe Np 4 Heavy Duty Non Presure Pipe 1000 Mm Diameter 2547 Rcc Pipe Np4 Heavy Duty Non Presure Pipe 1200 Mm Diameter 2548 Rcc Pipe Np4 Heavy Duty Non Presure Pipe 900 Mm Diameter 2549 Cement 2550 Structural Steel 2551 Tmt Fe - 500 2552 Hcrm / Crs Reinforcement 2553 Tubular Steel 2554 Bitumen Vg 10 ( Bulk ) ( 80 / 100 ) 2555 Bitumen Vg 30 ( Bulk ) ( 60 / 70 ) 2556 Bitumen Vg 40 ( Bulk ) ( 30 / 40 ) 2557 Bitumen Vg 30 ( Packed ) ( 60 / 70 ) 2558 Bitumen Vg 40 ( Packed ) ( 30 / 40 ) 2559 Bitumen Vg 10 ( Packed ) ( 80 / 100 ) 2560 Sand - Natural 2561 Sand -V.S.I. ( Vertical Shaft Impact Crusher ) Quality Artifitial Sand 2562 Natural Sand - Screened ( For Plaster Work Only ) 2563 Bricks Ii Class 2564 Rubble Stone Excluding Royalty 2565 Aggregate 40 Mm ( Hand Broken ) Blasted Excluding Royalty 2566 Aggregate 25 Mm 2567 Aggregate 20 Mm 2568 Aggregate 12 Mm 2569 Aggregate 10 Mm 2570 Aggregate 6 Mm 2571 Stone Dust 2572 Soft Murum 2573 Hard Murum 2574 Water 2575 White Cement 2576 Plasticizer 2577 Stainless Steel Plate 2578 Emulsion Rs1 ( Hincol ) Bulk 2579 Emulsion Rs1 ( Hincol ) Packed 2580 Waste Plastic To Be Used In Bituminous Treatment As Per Irc Sp-098-2013 2581 Portland Slag Cement ( Psc ) 2582 Ground Granulated Blast Furnance Slag ( Ggbs ) 2583 Bitumen Vg-40 ( Bulk ( 30-40 Grade ) ) 2584 Stone Boulder Of Size 150 Mm And Below At Cruser Plant 2585 Supply Of Quarried Stone 150 - 200 Mm Size For Hand Broken At Site 2586 Boulder With Minimum Size Of 300 Mm For Pitching At Site 2587 Coarse Sand At Mixing Plant 2588 Coarse Sand At Site 2589 Murum At Site 2590 Fly Ash Conforming To Is: 3812 ( Part Ii & I ) Athmp Plant / Batching Plant / Crushing Plant 2591 Filter Media / Filter Material As Per Table 300-3 ( Mort&H Specification ) 2592 Close Graded Granular Sub-Base Material 53 Mm To 9.5 Mm 2593 Close Graded Granular Sub-Base Material 37.5 Mm To 9.5 Mm 2594 Close Graded Granular Sub-Base Material 26.5 Mm To 9.5 Mm 2595 Close Graded Granular Sub-Base Material 9.5 Mm To 4.75 Mm 2596 Close Graded Granular Sub-Base Material 9.5 Mm To 2.36 Mm 2597 Close Graded Granular Sub-Base Material 4.75Mm To 2.36 Mm 2598 Close Graded Granular Sub-Base Material 4.75Mm To 75 Micron Mm 2599 Close Graded Granular Sub-Base Material 2.36 Mm 2600 Stone Crusher Dust Finer Than 3Mm With Not More Than 10% Passing 0.075 Sieve. 2601 Coarse Graded Granular Sub-Base Material2.36 Mm & Below 2602 Coarse Graded Granular Sub-Base Material4.75Mm To 75 Micron Mm 2603 Coarse Graded Granular Sub-Base Material4.75 Mm To 2.36 Mm 2604 Coarse Graded Granular Sub-Base Material 9.5 Mm To 4.75 Mm 2605 Coarse Graded Granular Sub-Base Material 26.5 Mm To 4.75 Mm 2606 Coarse Graded Granular Sub-Base Material 26.5 Mm To 9.5 Mm 2607 Coarse Graded Granular Sub-Base Material 37.5 Mm To 9.5 Mm 2608 Coarse Graded Granular Sub-Base Material 53 Mm To 26 .5Mm 2609 Aggregates Below 5.6 Mm 2610 Aggregates 22.4 Mm To 2.36 Mm 2611 Aggregates 22.4 Mm To 5.6 Mm 2612 Aggregates 45 Mm To 2.8 Mm 2613 Aggregates 45 Mm To 22.4 Mm 2614 Aggregates 53 Mm To 2.8 Mm 2615 Aggregates 53 Mm To 22.4 Mm 2616 Aggregates 63 Mm To 2.8 Mm 2617 Aggregates 63 Mm To 45 Mm 2618 Aggregates 90 Mm To 45 Mm 2619 Aggregates 10 Mm To 5 Mm 2620 Aggregates 11.2 Mm To 0.09 Mm 2621 Aggregates 13.2 Mm To 0.09 Mm 2622 Aggregates 13.2 Mm To 5.6 Mm 2623 Aggregates 13.2 Mm To 10 Mm 2624 Aggregates 20 Mm To 10 Mm 2625 Aggregates 25 Mm To 10 Mm 2626 Aggregates 19 Mm To 6 Mm 2627 Aggregates 37.5 Mm To 19 Mm 2628 Aggregates 37.5 Mm To 25 Mm 2629 Aggregates 6 Mm Nominal Size 2630 Aggregates 10 Mm Nominal Size 2631 Aggregates 13.2 / 12.5 Mm Nominal Size 2632 Aggregates 20 Mm Nominal Size 2633 Aggregates 25 Mm Nominal Size 2634 Aggregates 40 Mm Nominal Size 2635 Binding Wire 2636 Bitumen ( Cationic Emulsion ) 2637 Bitumen Vg-30 ( Bulk ( 60-70 Grade ) ) 2638 Bitumen Vg -10 ( Bulk ( 80-100 Grade ) ) 2639 Bitumen ( Cutback ) 2640 Bitumen ( Emulsion ) 2641 Bitumen ( Modified Graded ) ( Bulk Cr-60 ) 2642 Geo Grids 2643 Geomembrane 2644 Geonets 2645 Geotextile 2646 Geotextile Filter Fabric 2647 Ldo 2648 Pavement Marking Paint 2649 Rcc Pipes 200 Mm Dia, 2.5 M Long For Drainage 2650 Quarry Spall 2651 Road Barricade Perforated Fench ( 2000 X 1000 X 40 Mm ) 2652 Road Barricade Sand Fillable Only 1 Mtr. [ 1000 ( L ) X 350 ( W ) X 760 ( H ) Mm ] 2653 Polypropylene Multifilament Woven Geotextile Fabric For Filter Layer ( Approved Opening Size0.075Mm & Water Permeability 9.00 Litres / Sqm / Second ) 2654 Polythene Bags 2655 Trap Stones Weighing Upto 20 Kilogram 2656 Trap Stones Weighing From 20 To 50 Kilogram 2657 Trap Stones Weighing From 50 To 100 Kilogram 2658 Trap Stones Weighing From 100 To 200 Kilogram 2659 Trap Stones Weighing From 200 To 300 Kilogram 2660 Trap Stones Weighing From 300 To 500 Kilogram 2661 Trap Stones Weighing From 500 To 1000 Kilogram 2662 Trap Stones Weighing From 1000 Kilogram And Above 2663 Laterite Stones Rubbles Upto 20Kilogram 2664 Laterite Stones Rubbles From 20 To 50 Kilogram 2665 Laterite Stones Rubbles From 50 To 100 Kilogram 2666 Gabions Boxes Of Mechanically Woven Hexagonal Shaped Wire Mesh Of Type, 10 Cm X 12 Cm. Edges Mechanically Selvedged ( Zinc+ Pvc ) Coated G.I. Wires As Per Bs: 443, Mesh Wire Dia.3.00 Mm, Edge Wire 3.70 Mm Sizea ) Gabion Size - 1.00 X 1.00 X 1.00 M 2667 Gabions Boxes Of Mechanically Woven Hexagonal Shaped Wire Mesh Of Type, 10 Cm X 12 Cm. Edges Mechanically Selvedged ( Zinc+ Pvc ) Coated G.I. Wires As Per Bs: 443, Mesh Wire Dia.3.00 Mm, Edge Wire 3.70 Mm Size B ) Gabion Size - 1.50 X 1.00 X 1.00 M 2668 Gabions Boxes Of Mechanically Woven Hexagonal Shaped Wire Mesh Of Type, 10 Cm X 12 Cm. Edges Mechanically Selvedged ( Zinc+ Pvc ) Coated G.I. Wires As Per Bs: 443, Mesh Wire Dia.3.00 Mm, Edge Wire 3.70 Mm Size C ) Gabion Size - 2.00 X 1.00 X 1.00 M 2669 Gabions Boxes Of Mechanically Woven Hexagonal Shaped Wire Mesh Of Type, 10 Cm X 12 Cm. Edges Mechanically Selvedged ( Zinc+ Pvc ) Coated G.I. Wires As Per Bs: 443, Mesh Wire Dia.3.00 Mm, Edge Wire 3.70 Mm Size D ) Gabion Size - 3.00 X 1.00 X 1.00 M 2670 Gabions Boxes Of Mechanically Woven Hexagonal Shaped Wire Mesh Of Type, 10 Cm X 12 Cm. Edges Mechanically Selvedged ( Zinc+ Pvc ) Coated G.I. Wires As Per Bs: 443, Mesh Wire Dia.3.00 Mm, Edge Wire 3.70 Mm Size E ) Gabion Size - 4.00 X 1.00 X 1.00 M 2671 Flexible Gabions Of Polypropylene Material Of 10 Mm Ø Four Strand Mesh Size Of 150Mm X 150 Mm Size A ) Gabion Size - 1.00 X 1.00 X 1.00 M 2672 Flexible Gabions Of Polypropylene Material Of 10 Mm Ø Four Strand Mesh Size Of 150Mm X 150 Mm Size B ) Gabion Size - 1.50 X 1.00 X 1.00 M 2673 Flexible Gabions Of Polypropylene Material Of 10 Mm Ø Four Strand Mesh Size Of 150Mm X 150 Mm Size C ) Gabion Size - 2.00 X 1.00 X 1.00 M 2674 Flexible Gabions Of Polypropylene Material Of 10 Mm Ø Four Strand Mesh Size Of 150Mm X 150 Mm Size D ) Gabion Size - 3.00 X 1.00 X 1.00 M 2675 Used Tyre Fender 2676 Geotextile Bags Of Sizes A ) Geotextile Bags Size - 1.00 X 0.70 M 2677 Geotextile Bags Of Sizes B ) Geotextile Bags Size - 2.00 X 1.50 M 2678 Geotextile Tube Of 20 Metre Long & A ) Geotextile Tube Diameter - 3.00 M 2679 Geotextile Tube Of 20 Metre Long & B ) Geotextile Tube Diameter - 1.50 M 2680 Dozer D-8 H ( Heavy ) 2681 Dozerd 80 A 12 ( Medium ) 2682 Dozer D-3 B ( Medium ) 2683 Hydraulic Excavator ( Beml Be 200, Tata Hitachi Ex200 Or 2684 Hydraulic Excavator ( Beml Be 200, Tata Hitachi Ex200 Or 2685 Excavator ( Jcb Js140 / Tata Hitachi Ex120 Or Equivalent ) ) 2686 Excavator ( Jcb Js140 / Tata Hitachi Ex120 ) 2687 Hydraulic Excavator ( Wheeled ) 2688 Hydraulic Excavator ( Wheeled ) 2689 Loader 1 Cum Bucket Capacity 2690 Loader1 Cum Bucket Capacity 2691 Motor Grader 3.35 Mtr Blade 2692 Tandem Vibratoryroad Roller 8 Tonne 2693 Static Road Roller 8 Tonne 2694 Pneumatic Road Roller 2695 Tipper -10 Cum 2696 Tipper -10 Cum ( 20 Km / Hr ) 2697 Tipper -6 Cum 2698 Tipper -6 Cum 2699 Tipper -6 Cum ( 20 Km / Hr ) 2700 Tipper -3.5 Cum 2701 Tipper -3.5 Cum ( 20 Km / Hr ) 2702 Tractor 2703 Tractor With Rotevator 2704 Tractor With Ripper 2705 Water Tanker 2706 Water Tanker ( 15 Km Per Hour ) 2707 Air Compressor 175 Cfm 2708 Air Compressor 510 Cfm 2709 Bitumen Pressure Distributor ( Spray Bar Width 4.5 Mtr. ) 2710 Bitumen Boiler Oil Fired 2711 Emulsion Pressure Distrubutor 2712 Hot Mix Plant 90-120 Tph Capacity ( Drum Mix Plant ) With Scada 2713 Hot Mix Plant 60-90 Tph Capacity ( Drum Mix Plant ) With Scada 2714 Hot Mix Plant 40-60 Tph Capacity ( Drum Mix Plant ) With Scada 2715 Hydraulic Chip Spreader ( 3 Mtr.Width ) 2716 Integrated Stone Crusher 100 Tph 2717 Integrated Stone Crusher 200 Tph 2718 Mastic Cooker 2719 Mechanicalbroom Hydraulic ( Width 2.25 Mtr. ) 2720 Motor Grader 3.35 Mtr Blade 2721 Paver Finisher Hydrostatic With Sensor Control100tph 2722 Paver Finisher Mechanical 100 Tph 2723 Pot Hole Repair Kit Mounted On Truck 2724 Road Marking Machine 2725 Batch Mixasphalt Plant 160 Tph With Scada 2726 Batch Mixasphalt Plant 120 Tph With Scada 2727 Batch Mixasphalt Plant 80 Tph With Scada 2728 Dumper 6 Cum Capacity With Vts 2729 Loader 1.00 Cumbucket Capacity 2730 Loader 1.00 Cumbucket Capacity 2731 Batching And Mixing Plant ( A ) 30 Cum Capacity With Scada 2732 Batching And Mixing Plant ( B ) 15-20 Cum Capacity With Scada 2733 Concrete Paver Finisher With 40 Hp Motor 2734 Concrete Pump Of 45 & 30 Cum Capacity 2735 Concrete Bucket 2736 Concrete Mixer ( A ) 0.28 - 04 Cum 2737 Concrete Mixer ( B ) 1 Cum 2738 Reversible Drum Concrete Mixer With Scada 2739 Transit Mixer 4.0 / 4.5 Cum 2740 Transit Mixer 4 / 4.5 Cum 2741 Transit Mixer3.0 Cum 2742 Transit Mixer 3.0 Cum 2743 Cement Concretebatch Mix Plant @ 175 Cum Per Hour ( Effectiveoutput ) With Scada 2744 Cement Concretebatch Mix Plant @ 75 Cum Per Hour With Scada 2745 Wet Mix Plant 100 Tph 2746 Wet Mix Plant 75 Tph 2747 Wet Mix Plant 60 Tph 2748 Vibrator ( Electrical ) 2749 Vibrator ( Diesel ) 2750 Crane ( A ) 80 Tonnes 2751 Crane 40 Tonne Capacity 2752 Crane 20 Tonne Capacity 2753 Crane 15 Tonne Capacity 2754 Crane 10 Tonne Capacity 2755 Crane 5 Tonne Capacity 2756 Cranes ( C ) 3 Tonnes 2757 Generator ( A ) 125 Kva 2758 Generator ( B ) 63 Kva 2759 Gsb Plant 50 Cum 2760 Kerb Casting Machine 2761 Piling Rig With Bantonite Pump 2762 Ripper 2763 Rotavator 2764 Truck 5.5 Cum Per 10 Tonnes 2765 Truck 5.5 Cum Per 10 Tonnes 2766 Truck 5.5 Cum Per 10 Tonnes 2767 Air Compressor With Pneumatic Chisel Attachment Forcutting Hard Clay400 Cfm 2768 Belt Conveyor System 2769 Boat To Carry Atleast 20 Persons 2770 Cold Mining Machine @ 20 Cum Per Hour 2771 Compressor With Guniting Equipment Along With Accessories 260 / 250 Cfm 2772 Generator 33 Kva 2773 Generator 100 Kva 2774 Generator 250 Kva 2775 Generator 325 Kva 2776 Joint Cutting Machine With2-3 Blades ( For Rigid Pavement ) 2777 Jack For Lifting 40 Tonne Capacity 2778 Piling Ring Including Double Acting Pile Driving Hammer ( Hydraulic Ring ) 2779 Plate Compactor 2780 Texturing Machine ( For Rigid Pavement ) 2781 Truck Trailor 30 Tonne Capacity 2782 Truck Trailor 30 Tonne Capacity 2783 Vibrating Pile Driving Hammer Complite With Power Unit And Accessories 2784 Pile Boring Machinary 325-400 Mm Dia. 2785 Pumping Charges 2786 Pile Boaring Machine 325 To 400 Mm 2787 Pile Boaring Machine 425 To 500 Mm 2788 Pile Boaring Machine 525 To 600 Mm 2789 Pile Boaring Machine 625 To 700 Mm 2790 Pile Boaring Machine 725 To 1050 Mm 2791 Bentonite Pump 2792 Guiniting Gun 2793 Chain And Pully 2794 Welding Machine 2795 Electric Drill Machin 2796 Electric Gas Cutting 2797 Rammer 2798 Polishing Machine With Polishman 2799 Tile Cutting Machine 2800 Hand Polishing With Polishman 2801 Tilepolishing Machine ( Grinder ) 2802 Black Smith With Tools - Ii Class 2803 Stone Cutter With Tools - Semi Skilled 2804 Mason I Class Skilled 2805 Mason Ii Class Skilled 2806 Carpenter I Class Skilled 2807 Carpenter Ii Class Skilled 2808 Plumber With Tools - Skilled 2809 Glazier With Tools - Skilled 2810 Tin Smith With Tools - Semi Skilled 2811 Painter I Class Skilled 2812 Painter Ii Class Skilled 2813 Head Fitter With Tools - Skilled 2814 Mechanic 2815 Lorry Driver / Mixer Operator 2816 Welder / Driller - Skilled 2817 Polishman - Semi Skilled 2818 Assistant Plumber - Skilled 2819 Maistry Skilled / Supervisor / Mate 2820 Vibrator Operator - Skilled 2821 Skilled Labour 2822 Boreman Skilled 2823 Asphalt Sprayer Skilled 2824 Minor Or Blaster Semi Skilled 2825 Quarry Man - Semi Skilled 2826 Painter / White Washer - Semi Skilled 2827 Labour For Excavation In Hard Rock ( Un Blast ) 2828 Tile Turner Semi Skilled 2829 Mazdoor - For Polishing 2830 Bar Bender Skilled 2831 Bhisti ( Mixing / Curing ) - Semi Skilled 2832 Mukadam - Semi Skilled 2833 Tar Handler - Semi Skilled 2834 Helper Un Skilled 2835 Tree Cutter - Semi Skilled 2836 Navaghani 2837 Mazdoor - Unskilled Heavy Male 2838 Mazdoor - Unskilled Heavy Female 2839 Below Boy 2840 Fitter With Tools I Class Skilled 2841 Fitter With Tools Ii Class Skilled 2842 Gun Man For Guniting 2843 Laboratory Assistant 2844 Labour For Tile Turning 2845 Excavator - Unskilled Heavy 2846 Breaker - Semi Skilled 2847 Hole Driller Semi Skilled 2848 Chiseler Semi Skilled 2849 Foreman Skilled 2850 Bandhani Semi Skilled 2851 Emgraver For Lettering Skilled 2852 Frabi - Weld - Drilling 2853 Khalashi / Diers 2854 Jack Hammer Operator 2855 Electrician 2856 Welder Skilled 2857 Labour For Traffic Regulation 2858 Watchman 2859 Compressor Operator / Driver 2860 Supervisor / Mate 2861 Blacksmith ( 1St Class ) Welder / Plumber / Electrician. 2862 Blaster ( Stone Cutter ) 2863 Mali 2864 Mazdoor / Dresser ( Semi Skilled ) 2865 Mazdoor / Dresser Sinker B116 Skilled 2866 Medical Officer 2867 Operator ( Grouting ) 2868 Para Medical Personnel 2869 Mazdoor Unskilled Female ( Light ) 2870 Painting Lettering Number 2871 Junior Engineer 2872 Surveyor 2873 Autocad Operator 2874 Attendent 2875 Computer Typist 2876 Tracer 2877 Total Station Operator 2878 Senior Engineer 2879 Assistant 2880 Operator / Fitter 2881 Mazdoor Unskilled Light Male 2882 Computer Operator 2883 Survey Helper 2884 Technician 2885 Skilled Assistants-On The Site 2886 Supervisor 2887 Valuation Expert 2888 Office Support Staff 2889 Co-Ordinator 2890 Senior Surveyor 2891 Revenue Expert 2892 Welder

Key Dates

Contact Information